SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G77730.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G77730.1
Domain Number 1 Region: 54-91,127-187
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-20
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT1G77730.1
Sequence length 265
Sequence
MSSPLAAKSNLTTTRSASLNIPHSTRTNHNHDLRYSLSAGPRTNEDRPASGNGVAGILYK
WVNYGQGWKRRWFVLQDGVLSYYRIHGPDKISLSVEMDRRSKLIGGESLRFICRHSKRGD
VHSPGKPLGQIHLKVSSIGQSISDGKRFTVFTGTKSLHLRAATSEDRASWIEALKAVKET
FPRMSNEELMASTTNVSVSTDKLRQRLMEEEVDETIIKDCEDIMKNNFLALHDEVMSLKR
YQYHLIDSLKNVSNSPIRPSNQSFS
Download sequence
Identical sequences Q9CA21
AT1G77730.1 3702.AT1G77730.1-P AT1G77730.1 NP_177896.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]