SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G77800.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G77800.2
Domain Number 1 Region: 951-1009
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000206
Family PHD domain 0.016
Further Details:      
 
Domain Number 2 Region: 277-327
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000126
Family PHD domain 0.028
Further Details:      
 
Weak hits

Sequence:  AT1G77800.2
Domain Number - Region: 1076-1132
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0377
Family PHD domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G77800.2
Sequence length 1374
Sequence
MNVDQCQWRKKMMGRGVDGGCGAEEKPYRPFRRVALDKENGYEDMGSLEIDFLAQASKNL
SERSPFDVPEDGSTSVLSVPTLPIALANLLKNHSDNKKRHKKSHSGADKKKKKSSRQGDK
LRSGSIWLEHEDYFRRLDFPDLETLSDLASLRSLSSRNCFSIPSVEYDSIDIQQRETDAS
AKNEDVVCGDGVVLEQIKNLLTKDISEGTVRKEEDVVKPMGVDNVGNGISSGSDYSGSLE
WVLGNRNRILLTSERPSKKRKLLGSDAGLGKLMVAAPCEGNALLCDFCCTGHHQLIVCTS
CKATVHKKCYGLLEDSGKPWLCSWCELENGRADSERPCLLCPKKGGILKPVLSKTENGGP
AEFAHLFCSLWMPEVYIEDLKKMEPILNFPGIKETRRKLLCNLCKVKSGACIRCCNVVVL
TLSMPDNPIVWIIFTGKCFVGIYYHNAVEAGNRLEVWGKHGCDTVELRAFCSKHSDIQES
GKSVEGGESNAAESRSPICHLPSESVGEGHLSNDEMGVDVGTPGTGSDISRNSDLQELES
PHSKFNLSATDNVESGMTGRSNEDERTLSKSLSFGLILKKLIDLGKVDVKDVAAEIGINP
DALRAKLTDGDLLPDLLGKVVKWLSQHAHMGSSDKGKNLKPKANGSVLKKEGSVSLAPDH
SPEEKNSIVLDQKVHHGKSSVIPSDDHGEQSNSSSSGVMMENAFSLRPNSSQNRGNLNCP
NPIILDLFNQEAYPGFNPHRYIHKELSELGKEQTLKSSTDSDVARMTTNFDGSEEGNKHL
QGAETFLQLSKARKLGILDLSPEDELEGELLYYQLQLLGTAVSRKQLSDNLVYEVAKKLP
LEIDEQHGRRWDDVLVNKYFHDVREARKQGRKEQRNKQAQAVLAAATAAAATSSRNTSLR
KDMSEEPAQQEMSTSRRKVVGSSHLVPQTKESLLKMAVSGPPSEKRSDHHTPDFLVENPR
TCDICRRSETIWNLIVVCSSCKVAVHIDCYKCAKESTGPWYCELCAESSSEPSFNFGEKP
NSSTECTLCGGTTGAFRKTTNGQWVHAFCAEWSLESTFRRGQINPVQGMESLAKKTDNCC
VCQRIYGACTKCSYGNCQTTFHPSCARSAGFHMTGGGKHPHKAYCEKHSMEQKAKAESQK
HGAEELKSLKHYRVELERLRLLCERIVKREKLKRELAISSHEILAAKRDHAARPLHVRNP
FSPPEVSSDSATTSIKGHPDSNISGSEAIQRSDDITIDSTVTDKRRGKGPLLMDTDQKTD
DSATSKSRFSRKLTERQILSGKTVPRKHCIVSPSVSEDGDNGSKPKKHVETFAKELVMTS
DEASFKNRRLPKGYFYVPVDCLQEDKPGNQKLASSDKPANQKTSSGDQSGKDDG
Download sequence
Identical sequences F4I8J4
AT1G77800.2 NP_001185422.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]