SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G78640.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G78640.1
Domain Number 1 Region: 152-262
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000785
Family B3 DNA binding domain 0.0099
Further Details:      
 
Domain Number 2 Region: 362-471
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000334
Family B3 DNA binding domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G78640.1
Sequence length 487
Sequence
MAEEQREISHENNVSLGSAETAIPLTNVSISPTKKEEQKTVYLVLFGRTIYVESSSLESE
ETVMPIVDVPKSPAKEDLTTHCSLDAESSEKGFPVDPYMGILGNNPNINSNVTCAGNKDL
TEDIIKFKKMRSLSKEKIVEEKGTRVLTELPPYTWTIKKTLKESDINHQCRLLLNTTDAE
NHIMRHLPTDDQKKIQEGIGVDVKAYDHDTYTEHDMVFKRHVKTSKSYVFNGGWAKAFVG
RRELKEGDKIGLFWAKKSQTFMSQEQQGTSPLNTDEALKSHHSFSQNPNYIESNLSRRYQ
TNFSLGSQRISGQFLMIPNPGFVDTSSMTNTHDTSLANFQTVPTTTNPKIILKEEKENEE
EQQYWTIKKELTKSDACQRLTLSKSSVEEHILKHLLPEDSQKIDKGKPGITVKVYDNDTD
TEHELCLAFQCSYVLKNGWVKTFVKRRGLEEGDMIGLFWECSTSKLHFSVLFRVNAKAPA
AEEKEAY
Download sequence
Identical sequences Q9SYL8
AT1G78640.1 GO.5808 3702.AT1G78640.1-P AT1G78640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]