SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT1G79000.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT1G79000.2
Domain Number 1 Region: 623-714
Classification Level Classification E-value
Superfamily TAZ domain 2.62e-23
Family TAZ domain 0.00076
Further Details:      
 
Domain Number 2 Region: 1581-1664
Classification Level Classification E-value
Superfamily TAZ domain 3.14e-23
Family TAZ domain 0.00021
Further Details:      
 
Domain Number 3 Region: 1500-1568
Classification Level Classification E-value
Superfamily RING/U-box 2.71e-16
Family ZZ domain 0.01
Further Details:      
 
Domain Number 4 Region: 1379-1435
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000906
Family ZZ domain 0.012
Further Details:      
 
Domain Number 5 Region: 1025-1066
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000664
Family PHD domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT1G79000.2
Sequence length 1741
Sequence
MNVQAHMSGQVSNQGTMSQQNGNSQMQNLVGGGSAPATGAGLGPSRVSPVDNDILKLRQA
MRIRIFNILQQKQPSPADEASKAKYMDVARRLEEGLFKIANTKEDYVNPSTLEPRLASLI
KGRQLNNYNQRHANSSSVGTMIPTPGLQHSGGNPNLMITSSGDATMAGSNNITTSAMNTG
NLLNSGGMLGGNLSNGYQHSSSNFGLGSGGNMSSMSSQRNTGQMMPTPGFVNSSTNNNSN
NGQSYLSVEASNNSGGFSTAPMMVPQTQQQQLRQDIGGQNSRMLQNHGSQMGVGLRPGMQ
QKLSNVSNSSINGGVGMNAKSVDSGTSYTNPIRNSQQAYDNLQRSGMQGDGYGTNNSDPF
GSGNLYGAVTSVGMMTNTQNANTASFQAVSRTSSSLSHQQQQFQQQPNRFQQQPNQFHQQ
QQQFLHQQQLKQQSQQQQRFISHDAFGQNNVASDMVTHVKHEPGMENPSESIHSQTPEQF
QLSQFQNQYQNNAEDRHAGSQILPVTSQSDMCTSVPQNSQQIQQMLHPHSMASDSVNGFS
NLSVGVKTESGMRGHWQSQSQEHTQMSNSMSNERHIQEDFRQRMSGTDEAQPNNMSGGSI
IGQNRVSTTSESLNPQNPTATTCRNGNGNRDPRFKNQQKWLLFLRHARHCKAPEGKCPDR
NCVTVQKLWKHMDSCAAPQCSYPRCLPTKTLINHHRSCKEPNCPVCIPVKAYLQQQANAR
SLARLKNETDAARSVNGGGISSDAVQTSAGAKSCTSPGADISGHLQPSLKRLKVEQSSQP
VDVETESCKSSVVSVTEAQSSQYAERKDHKHSDVRAPSKYFEVKAEVSDFSVQTRPGFKD
TKIGIAENIPKQRPVSQPDKQDLSDVSPMQETTKVEKEPESLKKENLAESTEHTSKSGKP
EIKGVSLTELFTPEQVREHIRGLRQWVGQSKAKAEKNQAMEHSMSENSCQLCAVEKLTFE
PPPIYCTPCGARIKRNAMYYTVGAGDTRHYFCIPCYNESRGDTILAEGTPMPKARLEKKK
NDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAEYTCPYCFIAEVEQSKRKPLPQSA
VLGAKDLPRTILSDHIEQRLFKRLKQERTERARAQGKSYDEIPTAESLVIRVVSSVDKKL
EVKPRFLEIFREDSYPTEFAYKSKVVLLFQKIEGVEVCLFGMYVQEFGSECAFPNQRRVY
LSYLDSVKYFRPEVRSYNGEALRTFVYHEILIGYLEYCKLRGFTSCYIWACPPLKGEDYI
LYCHPEIQKTPKSDKLREWYLAMLRKASKEGIVAETINLYDHFFMQTGECRAKVTAARLP
YFDGDYWPGAAEDLIYQMSQEEDGRKGNKKGMLKKTITKRALKASGQTDLSGNASKDLLL
MHRLGETIHPMKEDFIMVHLQPSCTHCCILMVSGNRWVCSQCKHFQICDKCYEAEQRRED
RERHPVNFKDKHALYPVEIMDIPADTRDKDEILESEFFDTRQAFLSLCQGNHYQYDTLRR
AKHSSMMVLYHLHNPTAPAFVTTCNACHLDIETGQGWRCEVCPDYDVCNACFSRDGGVNH
PHKLTNHPSLADQNAQNKEARQLRVLQLRKMLDLLVHASQCRSAHCQYPNCRKVKGLFRH
GINCKVRASGGCVLCKKMWYLLQLHARACKESECHVPRCRDLKEHLRRLQQQSDSRRRAA
VMEMMRQRAAEVAGGSGINMRALNQGCHFPEEEEREQCQPSSQMTRVLRDSGLMGFGWLI
F
Download sequence
Identical sequences F4IDH2
AT1G79000.2 NP_001185433.1.80155 AT1G79000.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]