SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G01710.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G01710.1
Domain Number 1 Region: 66-139
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-16
Family Chaperone J-domain 0.00098
Further Details:      
 
Weak hits

Sequence:  AT2G01710.1
Domain Number - Region: 160-218
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00719
Family PHD domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G01710.1
Sequence length 311
Sequence
MGDNNPNRSEAERLLGIAEKLLESRDLNGSKEFAILAQETEPLLEGTDQILAVVDVLLSS
APENRIKNQPNWYKILQIEDLTESSTDNDLIKKQYRRLALLLHPDKNRFPFADQAFRFVL
DAWEVLSTPTKKSQFDGDLNLIFTKVNLNTQKSKKKTTTNEKMSTFWTACPYCYSLHEYP
RVYQEYCIRCQNCQRAFHAASIPQLPPLIPGKDEYYCCWGFFPMGFVGGKGGEAAIANGV
DAAKFPNWMPPVFSSGGVAAPPSGNGVSFDGWSGGAAKRDNEAVRSNNGVGVNSDGTPKK
RGRGRPKKNPV
Download sequence
Identical sequences Q9ZU99
3702.AT2G01710.1-P AT2G01710.1 NP_565276.1.80155 AT2G01710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]