SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G01810.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G01810.1
Domain Number 1 Region: 627-688
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000208
Family PHD domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G01810.1
Sequence length 697
Sequence
MAITAYDALTERQKAPKVLLINDFAISSSSSSPPFFNLAATFRDNIRSFLREYAEIEDYT
IDGATVSTIFLGSQANGVVFPLYIIEQQISDSSPNPLCDFCRCFGWGHHYVTKRKYHMII
PNRDEWNEPLKRESLTLSSHLMHGLIHCNGFGHLLCINTDLDDPNHLSGDQIMDFWDRLC
STLHTRKISLDDTSKKGAMDLRLLHGVAYGRPWFGKWDYMFSHGSFGVKKDLYWRAILTL
SSIEVDKILEELSGTSKGRVMKKIIDFYRGSTESPLATLSDLLRFMLGFISKAPIERKTA
MALVAMSLDHVSYPTLRADENSEVCTSPDQESDDNGYESGRDTVLDDHNTTTSGIKPPQY
YSFDDLSRREHSRWPGRRLNDAAQAVLKVFKERNSTISRQDLREAVRSSIGDTGLIDFLL
KHIDKVLIGDQIVQRSTNPKSRMLQFSLRTINSRVQEQKRKKKRKVKPQETSECTSTTPG
LSPYDDILYLYQNLLLTYPDSDLYSEASQVILKCKSFVKEWSYQEQNHLTVSCQVLPNHE
ELLRDFTRLLPPGDLVAVPENATIRELKSAAEKVLRDTYCITETFEVLEIRNRYLEKLDD
NVSLKSQGNTEFMVKGFGLDIGTELRYEGGFDDWTVDCKCGARDDDGERMVACDACKVWH
HTLCNSIEDDEAVPSVFLCNMCYGDSLRSKKRNLSIR
Download sequence
Identical sequences Q9ZUA9
3702.AT2G01810.1-P AT2G01810.1 AT2G01810.1 NP_178290.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]