SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G02470.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G02470.2
Domain Number 1 Region: 182-244
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.64e-18
Family PHD domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G02470.2
Sequence length 247
Sequence
MEGITHPIPRTVEEVFSDFRGRRAGLIKALTNDMVKFYQTCDPEKENLCLYGLPNETWEV
NLPVEEVPPELPEPALGINFARDGMQEKDWVSLVAVHSDSWLLSVAFYFGARFGFGKNER
KRLFQMINELPTIFEVVSGNAKQSKDLSVNNNNSKSKPSGVKVAKMSSPPPKEEEEEEDE
SEDESEDDEQGAVCGACGDNYGTDEFWICCDACEKWFHGKCVKITPAKAEHIKHYKCPTC
SNKRARP
Download sequence
Identical sequences A0A178VSB3
NP_001189502.1.80155 AT2G02470.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]