SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G18090.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G18090.1
Domain Number 1 Region: 294-372
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 2.18e-20
Family SWIB/MDM2 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 455-509
Classification Level Classification E-value
Superfamily GYF domain 0.0000000000000017
Family GYF domain 0.00061
Further Details:      
 
Domain Number 3 Region: 62-127
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000244
Family PHD domain 0.016
Further Details:      
 
Weak hits

Sequence:  AT2G18090.1
Domain Number - Region: 122-193
Classification Level Classification E-value
Superfamily RING/U-box 0.0777
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G18090.1
Sequence length 824
Sequence
MPEIDLMRVDHCVSDVKLDDSSSSPPGFFDGGGVPLDSDVKLDEEDSDSLKKRGRRGRPP
RILAKASSPPISRKRREDEDVCFVCFDGGSLVLCDRRGCPKAYHPACVKRTEAFFRSRSK
WNCGWHICTTCQKDSFYMCYTCPYSVCKRCVRSSEYVVVRENKGFCGICMKTIMLIENAA
EANKEKVQVDFDDQGSWEYLFKIYWVSLKEKLGLSLDDLTKAKNPWKSSSSTAAKRRTTS
RVHEKDDGNSPGVMKIRRAKVRKMDAVSVSNLGPSLDSNCSLGDRLPQLTSAATWATNEL
LDFVGYMKNGDISVLSKYDVQTLVLEYVRRNNLQNSPQNSEIMCDSKLMRLFGKERVDNL
EMLKLLDSHFIDQVRSPVTDNSAGGVTETMSYQVNAGRSCDRLNTSEQHQEGESQQLNGH
SIQVRPSSSDSRNHAVVKPDTSATLSNKPIDGLDTNMVWLYGDPDGKIHGPFSLYNLRQW
NSSGHFPPELRIWRLGEQQHSSILLTDALNGQFHKTGLLQNHSIPKQEVTATIANDQNRS
VAVPKIESRILDFSPNSVCTDQSVISSSNSVITRSSDVSNKSGNNCSHAVPLDFSLSNER
DTVGFISLWDKRKVESSLLVQSPISCSLSLATLPRNSNCSLPPHERWSAGQTDGNSAATT
ACNQNGSLSGSAEKQVTATVQSCGQNWNAATPSSASNVWDSNSGLTSFPDNQEIDFLDLF
SPTFKFNFASTTTDWQPIVAGPDECDESVSDLLAEVEAMESQKRLPSPTSTFRGPEELLI
RHSINDSFSPAEGHSPALDVSKGDSMSSTNDLQMHSRSNSTVHF
Download sequence
Identical sequences Q94JX1
AT2G18090.1 3702.AT2G18090.1-P NP_849971.1.80155 AT2G18090.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]