SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G21850.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G21850.1
Domain Number 1 Region: 412-494
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.52e-16
Family C1-like domain 0.052
Further Details:      
 
Domain Number 2 Region: 154-238
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000012
Family C1-like domain 0.033
Further Details:      
 
Domain Number 3 Region: 35-112
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000126
Family C1-like domain 0.023
Further Details:      
 
Domain Number 4 Region: 618-704
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000541
Family C1-like domain 0.085
Further Details:      
 
Domain Number 5 Region: 267-345
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000544
Family C1-like domain 0.049
Further Details:      
 
Weak hits

Sequence:  AT2G21850.1
Domain Number - Region: 720-758
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0167
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.042
Further Details:      
 
Domain Number - Region: 568-591
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0576
Family variant PHD-like domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G21850.1
Sequence length 787
Sequence
MAELKHFSHECPLTSPKIAVDGICSICYKDDLVELACSPCDFSLCKGCSQLPQKVWHDFH
PDHPLEFCLHQYDQKPEHVVCSGCGNMTSGSFYKCKECEIYLDMGCALIASIFRGWDSKD
LLHYSHCHLLKRCRPGPDARGSCLLCELPLSPSSVCYGCVHCYSFVHERCIHFPREIAHP
VHLAHPLKRLDYTRTSLCHICGESIAGVPFGCLECDFDAHLRCLDSFLRGLMHKSHPHRL
IYRTKSHISFTENDQCQICRRSIVISLDSFFYCIQCSMVFHFECLEIPEFVVEKSHHIHP
LVCKFLPYEDEFLEYCGVCETMVYAGHHAYSCDECDFLGHIECILRKAAPSPLYLKDLYP
CSKDNTSSTYQLDHDTNEPKAELMVNTMKGHIHVMRFVDFRELDEKAKCNICRTKIRGSP
CKCETCSFQAHSFCAELGRPLKHRVHKHFLTLLPDAPAGTDVTMNCDICRDDIKGFNLFC
RICNFVIHTNCIFRGKHLFTESQRGQKIIGSCTAMSGCIQKEHLLDQIMVSKSYSMACDI
CEEVVCGKDKTIHMSSLRLSTFVYRLINESSLVSCVVCKDVYHPLCLEVNRQMRFCHPIH
PDHYLPLSFVSGSKCLACKLEIKKYGYHCSTCNISFHIKCSKAVIFPQQTSHNHRFYHFW
IADSKITRTCRVCAKPCGVSFYGCIGCDFNAHAECIAFPDNVKNQKHEHTLKLIGSRYFE
PDCFLCGERIVGKFGKSSNVLYSCKHCGKEFHLKCIMSTDDREAATEEDQYGDIYLMYLE
RHLLEVL
Download sequence
Identical sequences F4III1
3702.AT2G21850.1-P NP_179776.2.80155 AT2G21850.1 AT2G21850.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]