SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G24650.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G24650.1
Domain Number 1 Region: 639-737
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-21
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 2 Region: 814-909
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.14e-20
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 3 Region: 489-574
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.45e-19
Family B3 DNA binding domain 0.0084
Further Details:      
 
Domain Number 4 Region: 154-253
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-19
Family B3 DNA binding domain 0.015
Further Details:      
 
Domain Number 5 Region: 7-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-18
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 6 Region: 298-395
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-18
Family B3 DNA binding domain 0.0044
Further Details:      
 
Domain Number 7 Region: 938-1034
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-17
Family B3 DNA binding domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G24650.1
Sequence length 1045
Sequence
MANSRIYPQFFHTLVPSFHTHLMIPEDFFSEYIEGRSVAELKLDFSDKSWEVKLSDRRIT
DGWEEFVVANDFRIGDVVAFRYVGNLVFHVSNLGPNYYEIEHNDGESLLRKRLHQVDFSS
NNGDVCDSEELPKEKKAKTNSEEADAVSSSSSADKSCFMAIITALDLTTDTLYLPLHFTS
ANGLTRKNREIILTDGGERSRVLDLRFDESSGTFYISRGWRNFCDENGQKAGGFFLFKLV
GKGETLVLSFCPTESINGEENITREDSKDECSSLDSLMNIVEKKKYIPKPRGSPYSSYSP
SHKQFVTFTLPPDYARIGKLSLSAPFVRENGINKPGEICLLDKHGRKWLTSLLLDSKGTM
SLGKGWKEFVKANSLETGFTLKLIWEETTPVLSLCSPESNSDREQEEISKAIEKHSLFID
PSNRDKISNNDKEENMSWERKKDHLKSRDSTLSSQKQFVTITITPSSDRLVSLSNDSCLV
VVSLLYFDMRLPKVFTRENGINKPGRITLLGKDGIKQQTNLLFDKANGAMSLGHGWKDFV
KDNGLKTGDSFTLKLIWEDQTPVLSLCPADCSIDREAGGGRSETNQKKSLPIEPSTCKKI
RKDVNIKDDNSKEKNDKEESKSVDGERKYLRGTYLTPSSQKHFVTLTITPSSIKKDRLIL
SPQFARKNNIDKPGMIYLLDTDGTKWLISLQRDKKGTMSLGKGWKEFAEANDFKLGESFT
MELVWEDTTPMLSLLRTEFRSSKANEKESISSEHKTRESSPTIKNRIVTPALTPEDVKAC
KLILPSQFMKKIRTVDKERNHLKGRDLNPSCQKQFVTFTITPTCVGKNRLILSAQFAREN
NINQPGTIYLLDTDGRKWLTTVKRDKKGTMSLGKGWKEFADTKDLKSGDSFTMELIWEDT
NPVLSLLRTKFSSSKSNKEESIFLEPKSRDSSSPTIVNRFVTLALTPEDVTACKLILPSQ
FMKANGINNKLGKITLLGENGVEWPGYMLSLDGTLALGNGWEGFCEANGVKLGQTFTLEF
VNEQDTTTTPVLKFSSVETIYKNVN
Download sequence
Identical sequences P0CAP5
AT2G24650.1 AT2G24650.1 NP_180041.5.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]