SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G24680.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G24680.1
Domain Number 1 Region: 51-153
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.69e-20
Family B3 DNA binding domain 0.012
Further Details:      
 
Domain Number 2 Region: 337-435
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.43e-19
Family B3 DNA binding domain 0.0081
Further Details:      
 
Domain Number 3 Region: 187-275
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.24e-17
Family B3 DNA binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT2G24680.1
Sequence length 446
Sequence
MVLNSSDLGPSRCDIRDLPAPSSTNDQGKTELARKKKVKRSNTEIEADASSSDNSCFVAL
VTASNLRKDALYLPQDLTSSVGLERKYREIVVTDERERRSWALDLRFNKSSDTFYISRGW
RSFCDENGKKPGGVFVFKLVGNRETPVLSFCSTESINDGTQGHKNNKYNCMELKSKKKRM
RCRDSTSPSQNRFMTLTLTHDNLIKSRRYLPLSFTRDNGLDKPGMIFLLGKTGRKWEANL
LREASGRIVLTGKGWKEFAMANGLKSGELFTLEAILEKGTPMLSLVNTQSTNYRSQQGEC
SRDSEKESSICAEPSRGNKKWKATNNRKERRDSSSAIQNRYVTLTLTPEDVRACTLILPS
QFMKANGINKLGKKTLLGQNRKKWFAYLLSKSGFVALGSGWKGFCEANGVKTGESFNLEY
IDEQDTTPVFKFCSNSVEYVKFTSLP
Download sequence
Identical sequences P0CAP4
AT2G24680.1 NP_180044.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]