SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G24690.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G24690.1
Domain Number 1 Region: 93-194
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-24
Family B3 DNA binding domain 0.0074
Further Details:      
 
Domain Number 2 Region: 247-345
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-22
Family B3 DNA binding domain 0.0054
Further Details:      
 
Domain Number 3 Region: 677-774
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.02e-20
Family B3 DNA binding domain 0.0083
Further Details:      
 
Domain Number 4 Region: 576-637
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000235
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G24690.1
Sequence length 777
Sequence
MANSLILGSPINPEGEMMIQFSNNHDNNIEFQRRKKMKKNNPETETDSSSDLSCFVAQTG
ALLHLPQGFTSSNGSNRECRKSPRPIISSYSSSEKQFVTFTLAPVDGRHCRLRLPMQFTR
ENGINKPGKIYLVGKDGSKWLANLLLENNRGRMTLGDGWKSFVKANGLKTGDTYTFKLLW
EDTTPVLSLCFEEYNTDTRVGEESSKESLPAEPSSQEKIVKDDNNKDESSTWKREGNHLR
CKDSTSPSQNCTLTVTITPDSLEHGRLRLPLQFMTENSMNKPGEITLLGTDGAKWMASLL
LEKKGRMSLGKGWKDFAKANGLKTGDSITLEPIWEDRTPVLSIKSSSGKGQSEFSKESLS
IKPSSGNMTKKVENNREASRKYPPRSRESSSAIQNQFMALTPLRDIVSQVAHDLSIGEVI
NFRHKGDNMLRVSDLGSNCCGVQDLLAPSSNYDHDNISNISMKINPHIRKEAVTFSSYDG
YAHDNFEPPSKKKVKKNNPEMEADYLSDHSCFVSHVTTSSLHTNALSLEVKESLPIEPSI
KPNISEDDNNKEEDIIEENSSFEREKNHWICIDSISSSQNRFLTLTITPDSLKHGRLRLP
LQFMIENSMNKPGEITVLGKDGAKWLVSLLLERRGRMSLDASSGQETREAEKNREESSSL
WELEKRTYCPRKRDSSSDVKNRFLTLTLAPEDVKDGNLHLPCQFMRINGINKPGQITLLG
RGGMKWFAYLLSGDGTVVVGNGWKGFCEANGVMLGETFVLEFIPKDDTNHVFKFYTK
Download sequence
Identical sequences Q8S8E8
NP_180045.5.80155 AT2G24690.1 AT2G24690.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]