SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G24700.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G24700.1
Domain Number 1 Region: 150-246
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.55e-21
Family B3 DNA binding domain 0.016
Further Details:      
 
Domain Number 2 Region: 270-367
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-20
Family B3 DNA binding domain 0.0049
Further Details:      
 
Domain Number 3 Region: 9-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-19
Family B3 DNA binding domain 0.0056
Further Details:      
 
Domain Number 4 Region: 459-553
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-16
Family B3 DNA binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G24700.1
Sequence length 555
Sequence
MANPLLYSPINPQFFQPLLPGFTNHLDIPVAFFLKYLVGTNVGKTAELRSDASEMTWKVK
IDGRRLSNGWEDFTIAHDLRVGDIVVFRQEGELVFHVTALGPSCCEIQYGEDTLEEDKIE
KLCGTENVSSKKKSLKREAESAPDNSLDSCFVATVTGSNLKRDTLYIPKEFALSNGLMNK
YQIVLMNEEGESWKIDLRREAYNYGRFYMRRGWRSFCIANGKKPGDVFAFKLVKNEETPM
IQLFPMTIEDLDKLQSLPRHKIRKTEAAPSSPDLSSFVATVTASNLSRDRLYLPKTFIMS
NGLLKKFQMCLMNEEGESWTIDVKHEAHTGRFLTIRGWRRFCVANGKKPGDLLKFKLVHN
EETPVLQLLPLNSEDLHKLNPSNDTRHGQSLKVTKKEFLGMEATENEFLGEEVYCNDSFK
ASEKDTLPFAEPINEDIRQGQCSQTIKQEYVSTEEKNSTSQNRFVTLTLTHSSKLNLPFE
FMKRNGIKKAGKITMVDRYDAKWRTSLLMDKIGTMSLGRGSKGFCEVNGVEMNESFILEL
IWEDTVPLLKFCSKV
Download sequence
Identical sequences P0DH85
NP_180046.2.80155 AT2G24700.1 3702.AT2G24700.1-P AT2G24700.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]