SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G27410.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G27410.1
Domain Number 1 Region: 90-202
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000173
Family B3 DNA binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G27410.1
Sequence length 257
Sequence
MYACARTTKINHFRGTSTTQNPNRGLEPSPSSYVTRRSKEKRPINVEKRSHKKRKIICPL
EEEPIQTTPPEWLLNVMRREENGYNPKLISTRQLYKTDLKKTEARLSVPFKQVKTPDFLT
EDETRIIHENAMKIRDNGVPVNFVDPELNKHVLELRKWKMKGNWIYVFVKGWKNVLDACK
TLFKEDDVYPLWSFRSGTGKLCFALTPKNSGRGNSLPGGDGASTSGESGQVPLPIPPARY
SSNSGQGCSGESSSSSS
Download sequence
Identical sequences Q9XIP5
NP_180310.2.80155 AT2G27410.1 AT2G27410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]