SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G27980.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G27980.1
Domain Number 1 Region: 691-743
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000453
Family PHD domain 0.0049
Further Details:      
 
Domain Number 2 Region: 784-840
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000123
Family PHD domain 0.017
Further Details:      
 
Domain Number 3 Region: 946-1032
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000709
Family N-acetyl transferase, NAT 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G27980.1
Sequence length 1072
Sequence
MAKGTATGEFVAVSQVRTGCKRELQFVLKSQSEICGGESLGRTRGSRNLNGESRSVEVKK
SIRASGLKSGIKKMRFSKDEEVGEVVMSDTVGVGLEEEEVKSDVIDVDSALVESMSEDKG
LEEKNDVEIENGDDNVVMNEDHLLEQTEKVSEKVIEAEKVCSIGGDSVIDREIVVACPAG
LSVMEKMASRSCKVKLERGLVYAKPCKRLTRSMLKVEGIKSEVNADDDHVNPEKDAIGSE
DNCVDVSGSVAYVVEEELLEQNNVEICLGLPSRSSQMNGHSLCLGLPSRSFQMSGHSQGV
DKKAVNDTVDKPLRRFTRSLVKQESDSDNPNLGNTTEPADLVDVDMHANDVEMDGFQSPS
VTTPNKRGRPKKFLRNFPAKLKDIFDCGILEGLIVYYVRGAKVREAGTRGLKGVIKGSGV
LCFCSACIGIQVVSPAMFELHASSNNKRPPEYILLESGFTLRDVMNACKENPLATLEEKL
RVVVGPILKKSSLCLSCQGPMIEPCDTKSLVVCKSCLESKEPEFHNSPSKANDALNGSSR
PSVDPKSILRRSKSSPRQSNRREQPTRKSTEPGVVPGTILSESKNSSIKSNSHGKLTRKD
LRLHKLVFEDDILPDGTEVGYFVAGEKMLVGYKKGFGIHCSCCNKVVSPSTFEAHAGCAS
RRKPFQHIYTTNGVSLHELSVALSMDQRFSIHENDDLCSICRDGGELVCCDTCPRSYHKV
CASLPSLPSERWSCKYCVNMVEREKFVDSNLNAIAAGRVQGVDAIAEITNRCIRIVSSFV
TELPSVCVLCRGHSFCRLGFNARTVIICDQCEKEFHVGCLKERDIADLKELPEEKWFCSL
GCEEINTTLGNLIVRGEEKLSNNILNFLRKKEQPNEENCPDYKTTPDIRWRVLSGKLTSS
DDTKILLAKALSILHERFDPISESGTKGDLIPAMVYGRQTKAQDFSGMYCTMLAVDEVIV
SVGIFRVFGSELAELPLVATSKDCQGQGYFQCLFACIERLLGFLNVKHIVLPAADEAKSI
WTDKFGFTKMTDEEVKEYRKDYSVMIFHGTSMLRKSVPAPSAVSKTEASKEE
Download sequence
Identical sequences F4IHN9
NP_180365.6.80155 AT2G27980.1 AT2G27980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]