SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G28320.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G28320.1
Domain Number 1 Region: 170-337
Classification Level Classification E-value
Superfamily Bet v1-like 2.2e-40
Family STAR domain 0.0033
Further Details:      
 
Domain Number 2 Region: 12-117
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000289
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G28320.1
Sequence length 737
Sequence
MAFGSENESETKMEGWLYIIRSNRFGLHFSRKRYFVLGDHLLKSFKSISDSKTKNAGRSA
VIDSCIRVTDNGRENVHRKAFFIFTLYNTSNHNDQLKLGASSPEDAARWINLIKEAALKG
APFPGDVFNCSRSRWDSLRLSSSVRDHHSNSIDWTLRSSARVDPVTTDVVAPSPWTIFGC
QNGLRLFKEAKERDSLGRWDDHPAIMAVGVVDGTSETIFQTLLSLGPSRSEWDFCFYQGS
VVEHLDGHTDIIHKQLYSDWLPWGMKRRDFSLRRYWRREDDGTYVILYHSVFHKKCPPQK
GYVRACLKSGGYVISPIDNGKQSVVKHMLAVDWKSWRSYVKPSLARSITVKMLGRISALR
ELFRAKHGSFPPNLSSGELSRSARLTQNEDGVFGDSSLRENEMFKDTANEERDKFPSERS
SLVDLDEFFDVPEPSDNDNLDDSWTSDFDLDTCCQESRQPKLNSATSLVKKLHDLAVQKR
GYVDLHERAKEESSPHATCNPPCCYGTTLPTDPSCDLPCSWTTTDPSTFLIRGKTYLDDQ
KKVKAKGTLMEMVAADWLKSDKREDDLGSRPGGIVQKYAAKGGPEFFFIVNIQVPGSTTY
SLVLYYMMSTPIEEHPLLVSFVNGDDAYRNSRFKLIPYISKGSWIVKQSVGKKACLIGQA
LEINYFRGKNYIELGVDIGSSTVARGVVSLVLGYLNKLVIEMAFLIQANTEEELPEYLLG
TCRFNHLDASKAISIIP
Download sequence
Identical sequences A0A178VNB6 F4IHT0
NP_180399.2.80155 3702.AT2G28320.1-P AT2G28320.1 AT2G28320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]