SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G30880.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G30880.1
Domain Number 1 Region: 31-131
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-16
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT2G30880.1
Sequence length 504
Sequence
MASNGASPRIVDATENSLDKIKRQLASGSGRNLLQGPLFKRSETLRKWNERWVILDPTTG
KMEYKTRRNEPTIKGTILFDENSTISISPVNFQGLPKYNGCCIYIGTPQKKDYFLCAETP
GAAKAWVTTLHATQLVLKAHKEAVESLSGSGSATLGTVATVVAAANSTALECSREIQAAM
QISLRNALKITPNKPIDGPLDDLTIMKETLRVKDEELHNLARELRSRDSMIKEIADKLSE
TAEAAVAAASAAHTMDEQRKIVCVEFERLTTDSQRQQEATKLKLKELEEKTFTLSKEKDQ
LVKERDAALQEAHMWRSELGKARERVVILEGAVVRAEEKVRVAEASGEAKSKEASQREAT
AWTEKQELLAYVNMLQTQLQRQQLETKQVCEEKTESTNGEASLPMTKETEKNVDKACLSI
SRTASIPGENVVHMSEEQVVNAQPPVGENEWNDIQATEARVSDVREISAETERDRRNSLD
IPVVSPEPNVPRNDPPSESFHHQP
Download sequence
Identical sequences A0A178VTA4 Q8VYJ6
AT2G30880.1 NP_850155.1.80155 AT2G30880.1 3702.AT2G30880.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]