SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G31650.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G31650.1
Domain Number 1 Region: 891-1035
Classification Level Classification E-value
Superfamily SET domain 7.06e-43
Family Histone lysine methyltransferases 0.0047
Further Details:      
 
Domain Number 2 Region: 295-419
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.91e-22
Family PWWP domain 0.0054
Further Details:      
 
Domain Number 3 Region: 603-676
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000421
Family PHD domain 0.014
Further Details:      
 
Domain Number 4 Region: 205-250
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000431
Family Tudor domain 0.0054
Further Details:      
 
Weak hits

Sequence:  AT2G31650.1
Domain Number - Region: 714-753
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000117
Family PHD domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G31650.1
Sequence length 1062
Sequence
MACFSNETQIEIDVHDLVEAPIRYDSIESIYSIPSSALCCVNAVGSHSLMSKKVKAQKLP
MIEQFEIEGSGVSASDDCCRSDDYKLRIQRPEIVRVYYRRRKRPLRECLLDQAVAVKTES
VELDEIDCFEEKKRRKIGNCELVKSGMESIGLRRCKENNAFSGNKQNGSSRRKGSSSKNQ
DKATLASRSAKKWVRLSYDGVDPTSFIGLQCKVFWPLDALWYEGSIVGYSAERKRYTVKY
RDGCDEDIVFDREMIKFLVSREEMELLHLKFCTSNVTVDGRDYDEMVVLAATLDECQDFE
PGDIVWAKLAGHAMWPAVIVDESIIGERKGLNNKVSGGGSLLVQFFGTHDFARIKVKQAI
SFIKGLLSPSHLKCKQPRFEEGMQEAKMYLKAHRLPERMSQLQKGADSVDSDMANSTEEG
NSGGDLLNDGEVWLRPTEHVDFRHIIGDLLIINLGKVVTDSQFFKDENHIWPEGYTAMRK
FTSLTDHSASALYKMEVLRDAETKTHPLFIVTADSGEQFKGPTPSACWNKIYNRIKKVQN
SDSPNILGEELNGSGTDMFGLSNPEVIKLVQDLSKSRPSSHVSMCKNSLGRHQNQPTGYR
PVRVDWKDLDKCNVCHMDEEYENNLFLQCDKCRMMVHAKCYGELEPCDGALWLCNLCRPG
APDMPPRCCLCPVVGGAMKPTTDGRWAHLACAIWIPETCLSDVKKMEPIDGVNKVSKDRW
KLMCTICGVSYGACIQCSNNSCRVAYHPLCARAAGLCVELENDMSVEGEEADQCIRMLSF
CKRHRQTSTACLGSEDRIKSATHKTSEYLPPPNPSGCARTEPYNCFGRRGRKEPEALAAA
SSKRLFVENQPYVIGGYSRLEFSTYKSIHGSKVSQMNTPSNILSMAEKYRYMRETYRKRL
AFGKSGIHGFGIFAKLPHRAGDMMIEYTGELVRPSIADKREQLIYNSMVGAGTYMFRIDD
ERVIDATRTGSIAHLINHSCVPNCYSRVITVNGDEHIIIFAKRHIPKWEELTYDYRFFSI
GERLSCSCGFPGCRGVVNDTEAEEQHAKICVPRCDLIDWTAE
Download sequence
Identical sequences Q9C5X4
AT2G31650.1 AT2G31650.1 NP_850170.1.80155 3702.AT2G31650.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]