SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G31862.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G31862.1
Domain Number 1 Region: 14-64
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000326
Family B3 DNA binding domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT2G31862.1
Sequence length 174
Sequence
MWVNLSCMCHIVDKLLELNLRRWNMRSTSIYVLASRWKKVVSDNTLIEGQRIRLWSFHSL
AKLYIALVPLDPAPAPTLAILLAPAPTPSSPPVVTRDSDELYISHADAQEEGDRILPVHA
DNDWECLNLLAKVSEETTCLEVSQEANRRSSLVSDTELDLELRLSLPGKNSYVM
Download sequence
Identical sequences A0A178VXY3 Q6DSS2
NP_973577.1.80155 AT2G31862.1 3702.AT2G31862.1-P AT2G31862.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]