SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G34000.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G34000.1
Domain Number 1 Region: 82-139
Classification Level Classification E-value
Superfamily RING/U-box 2.14e-17
Family RING finger domain, C3HC4 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G34000.1
Sequence length 151
Sequence
MGFNDPSLNTIILWFASVTSLVTISVIFALLIICLLKRRRFDVSPETENENQGRREPRCQ
GLSASVIAAFPTFSYKPDNNDPESNNQEIECPVCLGLIPKNVVIKVLPNCMHMFDEECIG
KWLESHATCPVCRRLAEPMTSNGDKVLERIV
Download sequence
Identical sequences O22953
3702.AT2G34000.1-P AT2G34000.1 NP_180947.1.80155 AT2G34000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]