SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G36720.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G36720.1
Domain Number 1 Region: 604-661
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.53e-16
Family PHD domain 0.005
Further Details:      
 
Domain Number 2 Region: 713-761
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000206
Family PHD domain 0.011
Further Details:      
 
Weak hits

Sequence:  AT2G36720.1
Domain Number - Region: 859-946
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000556
Family N-acetyl transferase, NAT 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT2G36720.1
Sequence length 1007
Sequence
MKEDLVPESNSSVWQSPVKRLAVDGECGEAGDRSRTSCKRIKTTQVNGFIVYTRTRKTKF
TKLHEQEDENAGLSNHLEESKPTSGVTSGFGGDMCRSSSVGETNVSGSSCVKNTLVESSS
GKVVVIERLVTGGLAESPAVETDSSSLVDVVIDDINFVELLHEAIPVEILSEGSLDFEVK
RLGTKVRTMGKSYSVSEKKKHGSFKRTAQIYKSIVRMKKVNNLVPENVEVLAEPDFGREG
LDEQSHSVSLADKSILIRSRPETVRDLFETGLLDGLSVVYMGTVKSQAFPLRGIIRDGGI
LCSCSSCDWANVISTSKFEIHACKQYRRASQYICFENGKSLLDVLNISRNTPLHALEATI
LDAVDYASKEKRFTCKRCKGPFPFSSLGHRGFLCKSCSEVETSQASLAATRTSTSAPACI
TSPVKSRLKITRKPSESTSISPVFMSSLGNSTRKITRKALRQALVGKAYLSASTNVSSQK
KCRSKFKKMLTQHSVTPKALKSVSLSVSSKKRSYRLARKDQGLHKLVFDRGGLPEGTELG
YYARGQKLLGGYKMGAGIYCYCCKCEVSPSLFEAHAGWASRRKPYFYIYTSNGVSLHEWA
TTFSHGRKYSANDNNDLCVICADGGNLLLCDSCPRAFHIECVSLPSIPRGNWHCKYCENK
FTSEIAGEYNVNSSAVGQLEGVDPVDQLAGRCIRVVKNMEAETNGCVLCSGSDFCRSGFG
PRTIIICDQCEKEYHIGCLSSQNIVDLKELPKGNWFCSMDCTRINSTLQKLLLGGAEKLS
DSSLGIIQTKQERNDVYSISDLDIRWRLISGKVTSPESRMLLSQALAIFHDCFDPIVDPL
SGSNLIPRMVYGKTMQGQDYGGICCAVLTVNATVVSAGLLRVFGREVAELPLVATRMCSR
EKGYFQLLFSCIEKLLSSLNVESIVVPAAEEAEPLWMNKFGFRKLAPEQLSKYIKICYQM
VRFKGASMLQKPVDSHQIIDKTIETGASLEENFDLKQANELYVHPLC
Download sequence
Identical sequences Q8RWG0
3702.AT2G36720.1-P NP_001324556.1.80155 NP_850270.1.80155 AT2G36720.1 AT2G36720.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]