SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G38130.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G38130.1
Domain Number 1 Region: 22-165
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.61e-30
Family N-acetyl transferase, NAT 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G38130.1
Sequence length 190
Sequence
MEKEMEDKEEFDEGEIEYTSYAGEHHLPLIMSLVDQELSEPYSIFTYRYFVYLWPQLCFL
AFHKGKCVGTIVCKMGDHRQTFRGYIAMLVVIKPYRGRGIASELVTRAIKAMMESGCEEV
TLEAEVSNKGALALYGRLGFIRAKRLYHYYLNGMDAFRLKLLFPKPRVPQIPSQVQTQQE
YETFPRPRVP
Download sequence
Identical sequences O80438
AT2G38130.1 AT2G38130.2 NP_181348.1.80155 NP_973629.1.80155 3702.AT2G38130.2-P AT2G38130.1 GO.11625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]