SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AT2G39020.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G39020.1
Domain Number 1 Region: 33-94,131-225
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.6e-29
Family N-acetyl transferase, NAT 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G39020.1
Sequence length 236
Sequence
MAAAAPPPPPTAAPEPNMVAPLISPIGHPMFSRIRLATPSDVPFIHKLIHQMAVFERLTH
LFSATESGLASTLFTSRPFQSFTVFLLEVSRSPFPATITSSPSPDFTPFFKTHNLDLPID
DPESYNFSPDMLNDVVVAGFVLFFPNYSSFLSKPGFYIEDIFVREPYRRKGFGSMLLTAV
AKQAVKMGYGRVEWVVLDWNVNAIKFYEQMGAQILQEWRVCRLTGDALEAFDQVNI
Download sequence
Identical sequences Q9ZV06
AT2G39020.1 NP_181435.1.80155 AT2G39020.1 3702.AT2G39020.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]