SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G40220.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G40220.1
Domain Number 1 Region: 54-111
Classification Level Classification E-value
Superfamily DNA-binding domain 1.18e-20
Family GCC-box binding domain 0.00022
Further Details:      
 
Weak hits

Sequence:  AT2G40220.1
Domain Number - Region: 181-214
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0654
Family beta-sandwich domain of Sec23/24 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G40220.1
Sequence length 328
Sequence
MDPLASQHQHNHLEDNNQTLTHNNPQSDSTTDSSTSSAQRKRKGKGGPDNSKFRYRGVRQ
RSWGKWVAEIREPRKRTRKWLGTFATAEDAARAYDRAAVYLYGSRAQLNLTPSSPSSVSS
SSSSVSAASSPSTSSSSTQTLRPLLPRPAAATVGGGANFGPYGIPFNNNIFLNGGTSMLC
PSYGFFPQQQQQQNQMVQMGQFQHQQYQNLHSNTNNNKISDIELTDVPVTNSTSFHHEVA
LGQEQGGSGCNNNSSMEDLNSLAGSVGSSLSITHPPPLVDPVCSMGLDPGYMVGDGSSTI
WPFGGEEEYSHNWGSIWDFIDPILGEFY
Download sequence
Identical sequences A0MES8
NP_181551.1.80155 AT2G40220.1 3702.AT2G40220.1-P AT2G40220.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]