SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G40770.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G40770.1
Domain Number 1 Region: 263-305,354-389,499-692
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-36
Family Tandem AAA-ATPase domain 0.0014
Further Details:      
 
Domain Number 2 Region: 701-727,759-787,852-868,1423-1618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.32e-35
Family Tandem AAA-ATPase domain 0.002
Further Details:      
 
Domain Number 3 Region: 1337-1397
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000381
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 4 Region: 409-488
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000354
Family PHD domain 0.011
Further Details:      
 
Weak hits

Sequence:  AT2G40770.1
Domain Number - Region: 817-881
Classification Level Classification E-value
Superfamily TPR-like 0.000443
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT2G40770.1
Sequence length 1664
Sequence
MGRRKQSKPQRAVGLITPTGSESDRNQLPGDEAEGSGDKNVEDIDKPYYVNICLSSRVSE
QQQNFDLAEVVLTNFSVRERVGSSSTFTKPIEVDHDLDCSLRFRLCNVTNFVDRIKLGHW
PVLSSSDITLELVDNKVSDDEVGSVIWSASFDGPGEGVSGLAHLASIKFLTLRLMPGNEG
LLSPRVRVEMLQQAFDACDSLLENTRQIWKKSMIHVMSWLRPEVMTSEARYGTRFNVKDI
ESSVVTEDETLDSSKQSSFDAAAFYEAIKPSKTDAMLGDDIADLLPELRPYQRRAAYWMV
QRERGDPITLGDKEDNQFISPLSISVGFLDSATKMFLNPFSGNISLTPEYFSPRIQGGIL
ADEMGLGKTVELLACIFSHRKPAEDEISVSNGSSVTDVLNAGLRRLKRERVECICGAVSE
SHKYKGVWVQCDLCDAWQHADCVGYSPKGKGKKDSQHIDEKASQKKSKKDATEIIVREGE
YICQMCSELLQVTASPISTGATLIVCPAPILPQWHSEITRHTRLGSLITCIYEGVRNASL
SEEPMIDITELLNADIVLTTYDVLKEDLTHDFDRHDGDRHCLRFQKRYPVIPTPLTRIFW
WRICLDEAQMVESNAAAATEMALRLYTKHRWCITGTPIQRKLDDLFGLLKFLKANPFDVS
RWWIEVIRDPYERRDTKAMEFTHKFFKQVMWRSSKVHVADELQLPPQEECVSWLKFSAIE
EHFYSRQHDTCVSYAREVIETLKRDILKRGHTSSDNPLVTHAEAAKLLNSLLKLRQACCH
PQVGSSGLRSLQQSPMTMEEILMVLVKKTQSEGEEALRVLIVALNGIAAIAMLKQEFSEA
VSLYKEALSITEEHAEDFRLDPLLNIHILHNLAEILPMAKSYGGKLSASGRPETKIDVKD
DDHHRASKRQRINELESLTHDSSETVHQREAIAPDNGLKKDGECHEECKTLDIVCDTLKV
KYLSAFNSKLSAAQHEFKKSYNQVSESLSNMGKQRSVWWLDALQLTEQNKDFSSELTRKI
EEALHGNLNNSSSSRESSRFRTIHGMKLHLQTCMDMLERSRKKVIDRILEIDQTMEKPKL
EDIERISNCKYCNKNSDGPPCIHCELDELFQEYEARLFRLNKSRRGVMEIAAAEETVHLQ
KKRDARNLFLFGLSSRSKDLNASRGDDEEPTKRNAGDIVVLSKSPSETEIVLGVIRNHCK
THLDRESKLAATKHLHTLEVMRKEYVHARVLARDQAQLLRAYDEINMSTMRLQLRESEDD
TSIYALGRDELDVASVLNTNDKFMAQSSLLSIKGKLRYLKGLMKSKQKQESESPDLSSPI
HETVDASDPAEQESENLLKRDEACPICHEILRNQKMVFQCGHSTCCNCFFAMTERKSVQE
TLQKWVMCPICRQHTDVRNIAYADDRRNSSSSDQDHKDSEASLVVQGSYGTKIEAVTRRI
LWIKSSDPQTKVLVFSSWNDVLDVLEHAFAANSITCIRMKGGRKSQTAISKFKGSEKETQ
KTNSHQKEEKSIQVLLLLVQHGANGLNLLEAQHVILVEPLLNPAAEAQAVGRVHRIGQEK
PTLVHRFLVSGTVEESIYKLNRNKNTNLSSFSSRNTKNQDQQFLTLKDLESLFASPTAET
AEMEQNPGERQENLRDLPPSVAAALAAERRMKESNASSSTTNAS
Download sequence
Identical sequences F4II36
AT2G40770.1 NP_001318395.1.80155 NP_001325178.1.80155 NP_181609.4.80155 AT2G40770.1 3702.AT2G40770.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]