SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT2G45540.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT2G45540.2
Domain Number 1 Region: 2274-2564
Classification Level Classification E-value
Superfamily BEACH domain 2.62e-123
Family BEACH domain 0.00000000986
Further Details:      
 
Domain Number 2 Region: 2686-2756,2794-2908,2935-2982
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.35e-31
Family WD40-repeat 0.0076
Further Details:      
 
Domain Number 3 Region: 2154-2263
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-24
Family PreBEACH PH-like domain 0.0015
Further Details:      
 
Domain Number 4 Region: 447-589
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000594
Family Clostridium neurotoxins, the second last domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT2G45540.2
Sequence length 3001
Sequence
MEDDDERKLPEADIANPLHNRIEAFDTTLQGISSADRAFKDDDFEQVSLGDQEKAANESQ
GDLQEPGSFSNSDHGRSSFGGTEVVTYQLSGTQEMYDLMPMDDVQSDRLSSPGPEREAAY
SMQQSLSETSLDSVHHPESGYSPVHSPQKPKPKATVPNVSPELLHLVDSAIMGKPESLDK
LKNVVCGIENFGCGEESEATAFLVVDSLIATMGGVESFEEDEDSNPPSVMLNSRAAIVSG
ELIPWLPGLGDNVNFMSPRTRMVRGLLVILRSCTRNRAMCSTAGLLGVLLRSVEAIISKD
VDMKWNAAAILLLCIQHLAGHSLSVDDLHRWLQVIKAAITTAWSSPLMLALEKAMSGKES
RGPACTFEFDGESSGLLGPGESRWPFTNGYAFATWIYIESFADTLNAATAAAAIAAAAAA
KSGKTSAMSAAAAASALAGEGTAHMPRLFSFLSADNQGIEAYFHAQFLVVESGSGKGRKS
SLHFTHAFKPQCWYFIGLEHSCKQGLLGKAESELRLYIDGSLYESRPFDFPRISKPLSFC
CIGTNPPPTMAGLQRRRRQCPLFAEMGPVYIFKEPIGPERMARLASRGGDVLPCFGNGAG
LPWLATNDYVRNKAEESSILDADIGGYTHLLYHPCLLSGRFCPDASLSGAAGTLRRPAEV
LGQVHVATRMKPVESFWALAYGGPMSLLPLTVSSVHKDSLEPCLGNLPLSLSTVTLAAPV
FRIMSVAIQHPGNNEELCRTQGPEILARILSYLLHSLASLDRKHDGVGEEELVAAIVSLC
QSQKINHVLKVQLFRTLLLDLKIWSLCNYGLQKKLLSSLQDMVFTEATAMRDAEAIQLLL
DGCRRCYWMISEKDSETTFPLDGNTRQMGELNALIDELLVIIELLMGAASPSLAADDLRR
LLGFIIDSPQPNQVHCKFNANASAVCSLLALLLIKLVPLFRSQIMYMNSRKPSYNGLHGE
MWVISRENGLTDCTRLCWLVVQPNAARAQMFAEVFITSGGIETLLVLLQREAKTGEDNVL
AMGRSGKRSSTDPSEKSPYNESGSVKQLDSNPHDNEIGFDLPGPDGNSVEDDNVGSLNVP
ESVRQEKEHGSTPVVCDSDSVSISNSINTERLSAEIGGISLSISADSARNNVYNVDNSDA
VVVGIIRLIGALISSGHLTFDFDARSDVTSNILGSGLHENGGTMFDDKVALLLFALLKAF
QAAPNRLMTDNVYTTLLGASINASSTEDGLNFYDSGHRFEHSQLLLVLLRSLPSASKALQ
SRALQDLLFLACSHPENRSSLTTMEEWPEWILEILISNYEKDAGKQSASVGSCEVEDMIH
NFLIIMLEHSMRQKDGWKDIEATIHCAEWLSIVGGSSTGEQRIRREESLPIFKRRLFGGL
LDFAARELQAQTQVIAAAAAGVAAEGLAPKDAKAGAENAAQLSVFLVENAIVILMLVEDH
LRSQSKQTCATNAVASPSPLKKRTSTLTAIGESSEISSSRASLSSDSGKVPLDILASMAD
SSGQISAVAMERLTAASAAEPYESVSCAFVSYGSCAMDLAEGWKYRSRLWYGVGLPSKPS
SLGGGGSGSDSWKSTLEKDAHGNWIELPLVKKSVSMLQALLLDESGLGGGLGIGGGSGTG
MGGMTALYQLLDSDQPFLCMLRMVLLSMREEDYGEDNMLMRNLSSERSSGNSVTLDSGSQ
MSMRQSRSALLWSVLSPIINMPISDSKRQRVLVTACVLYSEVWHAISRDRRPLRKQYIEA
IVPPFIAVLRRWRPLLAGIHELATADGMNPLVVDDRALAADALPVEGALSMVTPEWAAAF
ASPPAAMSLAMIAAGAAGWEAPPPPTPSHLRRDSSMLERKTAKLQTFSSFQKPLEPPNNN
APPRPRDKAAAKAAALAAARDLERNAKIGSGRGLSAVAMATSAQRRNIGDMERLQRWNTS
EAMGVAWMECLQPVDTKSVYGKDFNALSYKFIAVLVASFALARNMQRSEIDRRMQDDIIA
ANRLCLGSRAWRKLIRYLAEMRCFFGPFGDGICSPERVFWKLDSMESFSRMRQSIRRNYS
GTDHHGAAADYDDQTETKSDNGSKGSQSNPPVVAAEVILMEIAYEEDEHGEGDQLDVKGN
AEEHKRDEGRISGSHEHASRTSAGNSDPRTSNDLEMVRDSSVVAPGFVPSELDERILLEL
PTSMVRPLRVVKGTFQITTRRINFIVDNRESQNLADHSDESQSGDQEKDRSWPMSSLHQI
YSRRYLLRRSALELFMVDRSNFFFDFGNTEGRRNAYRAIVQARPPHLNNIYLATQRPEQL
LRRTQLMERWARWEISNFEYLMQLNTLAGRSYNDITQYPVFPWIISDNSSESLDLSNPST
FRDLSKPIGALNPERLKKFQERYSSFEDPVIPKFHYGSHYSSAGAVLYYLARVEPFTTLS
IQLQGGKFDHADRMFSDFPGTWNGVLEDMSDVKELVPELFYLPEVLTNENSIDFGTTQLG
EKLDAVKLPPWAKNPVDFVHKQRRALESEHVSAHLHEWIDLIFGYKQRGKEAIMANNVFF
YITYEGTVDIDKITDPVQQRATQDQIAYFGQTPSQLLTVPHMKRMPLKDVLHMQTIFRNP
KEIKPYTVQTPERCNLPASAIQASSDSVVIVDMNVPAARVAQHKWQPNTPDGQGTPFLFH
HGKATTTSTSGSLMRMFKGPASSGTGDWQFPQAQAFASSGIRSSSVIAITSDGEIITGGH
ADNSIKLVSSDGAKTLETAFGHCAPVTCLALSPDNNFLVTGSRDSTVLLWRIHKAFTSRT
SVSEPSTGSGAPSSTSNTNLANTLANKGKKCRLEGPIQVLRGHRRELVCCCVSSDQGVVV
SSSESSDVLLHSIRKGRLIRRLVGVKADSLCISSDGVIMAWSSSEGSISVFTINGVLIAK
AKFPLFCSVGCMEISMDGQNALIGMNSCSNSDYSSSNDTSKDSKEIERLDVPSPSICFLN
LYTLQVFHVLKLGQGQDITALALNVDNTNLLVSTEDKQLIIFTDPALSLKVVDQMLKLGW
E
Download sequence
Identical sequences F4IG73
AT2G45540.2 AT2G45540.2 NP_001189752.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]