SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G05630.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G05630.1
Domain Number 1 Region: 342-503,546-592
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.35e-39
Family Phospholipase D 0.057
Further Details:      
 
Domain Number 2 Region: 679-895
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.24e-29
Family Nuclease 0.05
Further Details:      
 
Domain Number 3 Region: 217-341
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000504
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  AT3G05630.1
Domain Number - Region: 53-107,171-206
Classification Level Classification E-value
Superfamily PX domain 0.0085
Family PX domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G05630.1
Sequence length 1046
Sequence
MSTDKLLLPNGVKSDGVIRMTRADAAAAAASSSLGGGSQIFDELPKAAIVSVSRPDTTDF
SPLLLSYTLELQYKQFKWTLQKKASQVLYLHFALKKRLIIEELHDKQEQVREWLHSLGIF
DMQGSVVQDDEEPDDGALPLHYTEDSIKNRNVPSRAALPIIRPTIGRSETVVDRGRTAMQ
GYLSLFLGNLDIVNSKEVCKFLEVSRLSFAREYGSKMKEGYVTVKHLRDVPGSDGVRCCL
PTHCLGFFGTSWTKVWAVLKPGFLALLEDPFSGKLLDIMVFDTLGLQGTKESSEQPRLAE
QVKEHNPLRFGFKVTSGDRTVRLRTTSSRKVKEWVKAVDEAGCYSPHRFGSFAPPRGLTS
DGSQAQWFVDGHTAFEAIAFAIQNATSEIFMTGWWLCPELYLKRPFEDHPSLRLDALLET
KAKQGVKIYILLYKEVQIALKINSLYSKKRLQNIHKNVKVLRYPDHLSSGIYLWSHHEKI
VIVDYQVCFIGGLDLCFGRYDTAEHKIGDCPPYIWPGKDYYNPRESEPNSWEETMKDELD
RRKYPRMPWHDVHCALWGPPCRDVARHFVQRWNHSKRNKAPNEQTIPLLMPHHHMVLPHY
LGTREIDIIAAAKPEEDPDKPVVLARHDSFSSASPPQEIPLLLPQETDADFAGRGDLKLD
SGARQDPGETSEESDLDEAVNDWWWQIGKQSDCRCQIIRSVSQWSAGTSQPEDSIHRAYC
SLIQNAEHFIYIENQFFISGLEKEDTILNRVLEALYRRILKAHEENKCFRVVIVIPLLPG
FQGGIDDFGAATVRALMHWQYRTISREGTSILDNLNALLGPKTQDYISFYGLRSYGRLFE
DGPIATSQIYVHSKLMIVDDRIAVIGSSNINDRSLLGSRDSEIGVVIEDKEFVESSMNGM
KWMAGKFSYSLRCSLWSEHLGLHAGEIQKIEDPIKDATYKDLWMATAKKNTDIYNQVFSC
IPNEHIRSRAALRHNMALCKDKLGHTTIDLGIAPERLESCGSDSWEILKETRGNLVCFPL
QFMCDQEDLRPGFNESEFYTAPQVFH
Download sequence
Identical sequences Q9M9W8
3702.AT3G05630.1-P NP_187214.2.80155 AR2391 AT3G05630.1 AT3G05630.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]