SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G05670.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G05670.1
Domain Number 1 Region: 475-551
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.14e-16
Family PHD domain 0.0035
Further Details:      
 
Domain Number 2 Region: 412-461
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000353
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G05670.1
Sequence length 883
Sequence
MGKRNTSWARNSNRKVRSKDKGSDESDEDYVISDEDEEESEADLKEEYASSVDGEPSFDG
FNGSDAVEDEELDEVEEEDVMLRNVEWPKVKTGPRGNRKITGCKSRKTNQVVVSDNEDVD
LDDADDEDDEIRNSRNAVGKSGSLDGEKHQRIGLGKRRRVFYEIEDEDGDYPEEDGDEEE
ERDVENVDSNSLHDGEDGKMALEEQDNVSHETEKEDDGDYEDEDEDDDGDEDFTADEDVS
LDEEEEEEIIACNKNALKVCKGNKRKRRSGEGRKRRKKCSVAKTRLTRGRKRRVRNTKKG
VDEDDDDFVDDCLPARKKAKTKSSRPRPRRRCTVPSDSDVASSGESDYEYTISEEEREQI
REAGSLLKSSVNHASSIRQTTVNKDLPQLRKSPVKKGEKKVELVKRDVIKNVCGICLSEE
DMRRLKGTLDCCSHYFCFTCIMEWSKVESRCPLCKQRFRTISKPARSTPGVDLREVVIPV
PERDQVYQPTEEELRSYLDPYENIICTECHQGDDDGLMLLCDLCDSSAHTYCVGLGREVP
EGNWYCEGCRPVALGSASSQTHIISEQQRGSGFYSRPSPLVVSGQYQDVSLIVSPRTPFF
NGENLFSPRIPNGDAQGSSPSGLGATTLSRRRTLHRHIQNIINGDRLINMGARTGGTSSD
GFVTTQIGHGRTIDPSQPVASQETGISLYAISEERLPNNNSLISAHDPELLSPKLDEFGS
EEAFRRLSNNTFLGERPIDLGFHHGLAQGDPLVSNQQRLHSHMPNTMSSMAGERLQERVK
AHLKNLSSQNDLGQTTFDEISTCSIHTILAACGLEHESSEVHLVPPPVTCTHHHMTPGSS
SSSSSGSSLMKGCCYSCFDSFVEDVVKMILDTRQPHWLSLGLH
Download sequence
Identical sequences Q9M9X2
AT3G05670.1 NP_001325507.1.80155 NP_001325508.1.80155 NP_187218.1.80155 AT3G05670.1 3702.AT3G05670.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]