SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G06670.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G06670.2
Domain Number 1 Region: 15-110
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-17
Family Ran-binding domain 0.06
Further Details:      
 
Domain Number 2 Region: 321-692,736-747
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000185
Family Armadillo repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G06670.2
Sequence length 886
Sequence
MGAPEKSQSNTNSMQRVKVYHLNEDGKWDDRGTGHVSIDFVERSEELSLCVIDEEDNETL
LVHPINPEDIYRKQEDTIISWRDPERSTELALSFQETAGCSYVWDQICTMQRNLHFSSLN
SETFHSLNSELRELPAVELTTLPLILKIVTESGITDQMRLTELILKDHDFFRNLMGVFKI
CEDLENVDGLHMIFNIVKGIILLNSSQILEKIFGDELIMEIIGCLEYDPGVPHSQHHRNF
LKEHVVFKERQSHVFFVRKEHAHYGCFGISAIPIKDPLVLSKIHQTYRIGYLKDVVLARV
LDDAIVANLNSVIHANNAIVVSLLKDDSTFIQELFARLRSPSTSMESKKNLVYFLHEFCS
LSKSLQVVQQLRLFRDLINEGIFHVIEEVLQIPDKKLVLTGTDILILFLTQDPNLLRSYV
VRTEGNPLLGLLVKGMMEDFGDKMHCQFLEIIRTLLDANALSGGAQRANIMDIFYEKHLP
ELVDVITASCPEKSSNASEGAARRIFTKPEVLLNICELLCFCIMQDASRTKCSFLQNNVT
EKVLHLTRRKEKYLVVAAIRFVRTLLSVHDDYVQNYVVKNNLLKPIIDVFIANGTRYNLL
NSAVLDLLEHIRKGNATLLLKYIVDTFWDQLAPFQCLTSIQAFKVKYEQCLESAGPKSTS
DAVDPRRRVDERALEKEEEDYFNEDSDEEDSASASNTQKEKPASNIQKEQPKPHLSNGVA
ASPTSSSPRSGGLVDYEDDEDDEDYKPPPRKQPEASEDEEGELLRLKRKSALVEREQEPS
KKPRLGKSSKRENVFAVLCSTLSHAVLTGKKSPGPAGSAARSIVAKGAEDSKSSEENNSS
SSDDENHKDDGVSSSEHETSDNGKLNGEESLVVAPKSSPEMAVNGS
Download sequence
Identical sequences F4JC31
AT3G06670.2 AT3G06670.2 NP_001189831.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]