SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G09210.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G09210.1
Domain Number 1 Region: 96-213
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 6.41e-18
Family N-utilization substance G protein NusG, N-terminal domain 0.0022
Further Details:      
 
Domain Number 2 Region: 276-327
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000542
Family N-utilization substance G protein NusG, C-terminal domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G09210.1
Sequence length 333
Sequence
MMKLQGGLLQWSRSSLIPSIYTPINKTQFSIAACVIERNHQLTAKERRQLRNERRESKLG
YSWREEVEEKLIKKPKKRYATWTEELNLDTLAESGPQWWAVRVSRLRGHETAQILARALA
RQFPEMEFTVYAPSVQVKRKLKNGSISVKPKPVFPGCIFIRCILNKEIHDSIRDVDGVGG
FIGSKVGNTKRQINKPRPVDDSDLEAIFKQAKEAQEKADSEFEEADRAEEEASILASQEL
LALSNSDVIETVAESKPKRAPRKATLATETKAKKKKLAAGSTVRVLSGTFAEFVGNLKKL
NRKTAKATVGFTLFGKETLVEIDINELVPEIQS
Download sequence
Identical sequences Q94AA3
NP_566346.1.80155 AT3G09210.1 AT3G09210.1 3702.AT3G09210.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]