SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G10550.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G10550.1
Domain Number 1 Region: 217-496,535-654
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.5e-115
Family Myotubularin-like phosphatases 0.000000185
Further Details:      
 
Domain Number 2 Region: 52-176
Classification Level Classification E-value
Superfamily PH domain-like 3.63e-19
Family GRAM domain 0.016
Further Details:      
 
Weak hits

Sequence:  AT3G10550.1
Domain Number - Region: 666-717
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0288
Family Sec2 N-terminal region 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G10550.1
Sequence length 840
Sequence
MTPPRPPSGRVRSLRDYSSESEKMDGTGSWDTLEWTKLDSTSGSGSFSNLSCLLESERVI
VEGYGVVLINTDEAGTLLVTNFRILFLSEGTRKVIPLGTIPLATIEKFNKMVLKVQSSPR
QSDKIPPRRLLQVTGKDMRIIVYGFRPRTKQRRNVFDALLKCTKPERVWDLYTFACGPSK
FGNANPKERLLNEYFRLLGKSSIRASMDMIEDGAFTLSNELWRISDLNSNYNLCQTYPFA
FMIPKSISDAELLQACSFRARCRLPVITWCQPGSGAVIARSSQPLVGLMMNMRSNLDEKL
VAAFCSQLPGAKGERRKLYIADARPRKNALANGAMGGGSESSSNYFQSEIVFFGIDNIHA
MRESFSRVRDYLDMHGTTSSDGRSSFLRHGGWTWGGGNLSSMSASVSLLGDSGWLIHIQS
VLAGAAWIAARVAMESASVLVHCSDGWDRTTQLVSLACLLLDPYYRTFAGFQALVEKDWL
AFGHPFSDRVGMPNISGSGNFDFPRQSSSAGSFPSSPVRQSSGSAASQSSSSSHGHNNYS
PIFMQWIDSVSQLMRMYPCAFEFSPTFLVDFMDCLLSCRFGNFLCNSEKEREQCGIADAC
GCLWAYLTDLRSFSATSHVHCNPFYDPLKYDGPLLPPAASLAPTLWPQFHLRWACPEEAK
AADIGVQCRAMTVKYSEMQKEKEAAERRVDEISFAMESLSAELLRERHLSWVARESANRA
TKEYAALTRAVQSLGCKINFTTSDVEDDPRSSLENNPRRRNRHGNNSDVSVSISLMPEEN
TSGNPKGRVCEALCPLRTREGVCRWPEVGCAHVGSQFVGLKANFDAFDRLAIYDSYFQPK
Download sequence
Identical sequences A0A178V871 F4J3T8
NP_187666.5.80155 AT3G10550.1 3702.AT3G10550.1-P AT3G10550.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]