SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G12980.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G12980.1
Domain Number 1 Region: 615-696
Classification Level Classification E-value
Superfamily TAZ domain 7.06e-21
Family TAZ domain 0.00046
Further Details:      
 
Domain Number 2 Region: 1555-1635
Classification Level Classification E-value
Superfamily TAZ domain 2.88e-19
Family TAZ domain 0.00096
Further Details:      
 
Domain Number 3 Region: 1480-1553
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000494
Family ZZ domain 0.0072
Further Details:      
 
Domain Number 4 Region: 1359-1429
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000235
Family ZZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 1005-1045
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000144
Family PHD domain 0.0065
Further Details:      
 
Weak hits

Sequence:  AT3G12980.1
Domain Number - Region: 59-95
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.0418
Family Kix domain of CBP (creb binding protein) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G12980.1
Sequence length 1670
Sequence
MAQGQNRTVLQSGQMHNSVVASASSVSSQPNMVNGISQDTLLLRQEMLNRTYAWLQQRQP
SKTDDASKAKLSEVAKRLESAMWRTATSKEDYLDFRSFDVRVESTLKQLLSQRRANPSSS
VSTMVQTPGVSHGWGQSYTATPMVDTSKFNSSNNLSDATTETGRLLPTNRMYRGTINNGR
QELSAVGQMIPTPGFDNSANADVYQSHRNEEYSGDGGKLLATGSDFGNPSQLQKQRPTGS
NDLMGYNLDHQLGGGFRSNIHQNTSGMTSIPLNAGVGMSGNNVHLANVPRSSEGVLSSTH
FSTFSQPSQQPVEQLQVSHVNRYSMSNSGTFVSGNLYGVQTSSGSIETAVDMNSMSLNSM
RRVDTSFGSQSGLQNNPLLKPHLRHQFENGNFQSSSNSKENLAQVSHRPLERQFNQQAHY
GQYHQQELLMNNDAYRQSQPASNLVSQVKNEPRVEYYNEAFQMQAINKVEPSKPQNQYKQ
NTVKDEYVGAQSAPVSSSQLKMSPSFPPQTHQTQQVSQWKDSSSLSAGVQPVSGLGQWHS
SSQNLTPISKNSNEEREHFGVRFHKQHEGTNNSSSVRESTNCLTVAPSGTLDVPHLPVGI
NVLSKQLNGDCGLSYKNQRRWLLFLLHVRKCNAAEDNCESKYCFTAKTLLKHINCCKAPA
CAYQYCHQTRQLIHHYKHCGDEACPVCVFVKNFKEKQKEKFTFLQRAEPSSASLNHGPKE
SFESMRTSSERDSEAPFVVDDLQPSPKRQKVEKPSQFAYPDTQGNPATISAGVSQAHFSM
GLQEKDRLPSDVCKPVRSNVPMNADSSDSSRRLVPVSRELEKPVCKDTHMGRHGVKSALD
GESLRLSKQEKPKRMNEISAPKEENAEQSLGVVSASNCGKSKIKGVSLIELFTPEQVEEH
IRGLRQWVGQSKTKAEKNKAMGLSMSENSCQLCAVERLAFEPTPIYCTPCGARVKRNAMH
YTVVAGESRHYVCIPCYNEARANTVSVDGTPVPKSRFEKKKNDEEVEESWVQCDKCQAWQ
HQICALFNGRRNHGQAEYTCPNCYIQEVEQGERKPVSQNVILGAKSLPASTLSNHLEQRL
FKKLKQERQERARLQGKSYEEVPGADSLVIRVVASVDKILEVKPRFLDIFREDNYSSEFP
YKSKAILLFQKIEGVEVCLFGMYVQEFGTDSASPNQRRVYLSYLDSVKYFRPDVRTVSGE
ALRTFVYHEILIGYLDYCKKRGFSSCYIWACPPLKGEDYILYCHPEIQKTPKTDKLREWY
LAMLKKASKEKVVVECTNFYDHFFVQSGECRAKVTAARLPYFDGDYWPGAAEDLIDQMSQ
EEDGKKSNRKLMPKKVISKRALKAVGQLDLSVNASKDLLLMHKLGEIILPMKEDFIMVHL
QHCCKHCCTLMVSGNRWVCNQCKNFQICDKCHEVEENRVEKEKHPVNQKEKHVLYPVAID
NIPTEIKDNDDILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMILYHLHNPTVPAF
AMACAICQQELETAQGWRCEVCPDYDVCNACYSKGINHPHSIISRPSATDSVVQNTQTNQ
IQNAQLREVLLHVMTCCTAQCQYPRCRVIKGLIRHGLVCKTRGCIACKKMWSLFRLHSRN
CRDPQCKVPKCRELRAHFSRKQQQADSRRRAAVMEMVRQRAADTTASTPE
Download sequence
Identical sequences Q9LE42
NP_187904.1.80155 AT3G12980.1 3702.AT3G12980.1-P AT3G12980.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]