SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G14270.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G14270.1
Domain Number 1 Region: 1494-1758
Classification Level Classification E-value
Superfamily SAICAR synthase-like 1.11e-75
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00035
Further Details:      
 
Domain Number 2 Region: 452-624
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.51e-40
Family Group II chaperonin (CCT, TRIC), apical domain 0.00054
Further Details:      
 
Domain Number 3 Region: 34-105
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.02e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  AT3G14270.1
Domain Number - Region: 408-458,617-643
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.00198
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G14270.1
Sequence length 1791
Sequence
MGTRDSNNRTFSEIVGLIKSWLPWRSEPATVSRDFWMPDQSCRVCYECDCQFTLINRRHH
CRHCGRVFCGKCTANSIPFAPSDLRTPREDWERIRVCNYCFRQWEQGDGGPHVSNITELS
TSPSETSLLSSKTSTTANSSSFALGSMPGLIGLNQRVHHGSDVSLHGVSSMETSVTKQGK
ETSRRSSFIATDVEDPSRFALNSIRSDDEYDEYGAYQTDIETSHSPRANEYYGPMEYNGM
GIDDVPCKHLGGETADQKSLSGSPLIHQCLESLIREGSEQFQKKSEHDGRDECEASSPAD
ISDDQVVEPVDFENNGLLWVPPEPENEEDERESALFDEEDNEGDASGEWGYLRPSTSFGS
GEYRGEDRTTEEHKKAMKNVVDGHFRALLAQLLQVENISVSDEEGKESWLEIITSLSWEA
ANLLKPDMSKSGGMDPGGYVKVKCLASGFRHDSMVVKGVVCKKNVVNRRMSTKIEKARLL
ILGGGLEYQRVSNQLSSFDTLLQQEKDHLKMAVAKIHAERPNILLVEKSVSRFAQEYLLA
KDISLVLNIKRPLLDRIARCTGAQIIPSVDHLSSQKLGYCENFRVDRYPEEHGSTGQVGK
KVVKTLMYFEHCPKPLGFTILLRGANEDELKKVKHVVQYGVFAAYHLALETSFLADEGAS
PELPLNSPITVALPDKSTSIERSISTVPGFTVSTYEKSPTMLSCAEPQRANSVPVSELLS
TTTNLSIQKDIPPIPYGSGWQAREINPSFVFSRHNISLNLPDRVIESRNSDLSGRSVPVD
TPADKSNPIVVADETTNNSLHLSGQGFVRKSSQIGTSIMVENQDNGSELTIAQQQNNEKP
KETQSQKEEFPPSPSDHQSILVSLSSRSVWKGTVCERSHLFRIKYYGSFDKPLGRFLRDH
LFDQSYRCRSCEMPSEAHVHCYTHRQGSLTISVKKLQDYLLPGEKEGKIWMWHRCLRCPR
LNGFPPATLRVVMSDAAWGLSFGKFLELSFSNHAAASRVACCGHSLHRDCLRFYGFGNMV
ACFRYATIDVHSVYLPPSILSFNYENQDWIQRETDEVIERAELLFSEVLNAISQIAEKGF
RRRIGELEEVLQKEKAEFEENMQKILHREVNEGQPLVDILELYRIHRQLLFQSYMWDHRL
INASTLHKLENSDDTKREENEKPPLAKSQTLPEMNAGTNSLLTGSEVNLNPDGDSTGDTG
SLNNVQKEADTNSDLYQEKDDGGEVSPSKTLPDTSYPLENKVDVRRTQSDGQIVMKNLSA
TLDAAWIGERQTSVEIPTNNKVSLPPSTMSNSSTFPPISEGLMPIDLPEQQNEFKVAYPV
SPALPSKNYENSEDSVSWLSVPFLNFYRSINKNFLLSSQKLDTFGEHSPIYISSFREAEL
QGGPRLLLPVGLNDIVVPVYDDEPTSMIAYALMSPEYQRQTSAEGESLVSYPSELNIPRP
VDDTIFDPSRSNGSVDESILSISSSRSTSLLDPLSYTKALHARVSYGEDGTLGKVKYTVT
CYYAKRFEALRGICLPSELEYIRSLSRCKKWGAQGGKSNVFFAKTLDDRFIIKQVTKTEL
ESFIKFAPAYFKYLSESISTKSPTCLAKILGIYQVATKQLKSGKETKMDVLIMENLLFGR
TVKRLYDLKGSSRARYNPDSSGSNKVLLDQNLIEAMPTSPIFVGNKAKRLLERAVWNDTA
FLALGDVMDYSLLVGVDEEKNELVLGIIDFLRQYTWDKHLESWVKFTGILGGPKNEAPTV
ISPKQYKRRFRKAMTTYFLMVPDQWSPPNVVANNSKSDQPEETSQAGTQAE
Download sequence
Identical sequences Q9LUM0
AT3G14270.1 AT3G14270.1 NP_001319548.1.80155 NP_188044.1.80155 3702.AT3G14270.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]