SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G16785.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G16785.1
Domain Number 1 Region: 322-513,551-597
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.8e-42
Family Phospholipase D 0.053
Further Details:      
 
Domain Number 2 Region: 726-940
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.77e-28
Family Nuclease 0.082
Further Details:      
 
Domain Number 3 Region: 192-341
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000186
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G16785.1
Sequence length 1096
Sequence
MASEQLMSPASGGGRYFQMQPEQFPSMVSSLFSFAPAPTQETNRIFEELPKAVIVSVSRP
DAGDISPVLLSYTIECQYKQFKWQLVKKASQVFYLHFALKKRAFIEEIHEKQEQVKEWLQ
NLGIGDHPPVVQDEDADEVPLHQDESAKNRDVPSSAALPVIRPLGRQQSISVRGKHAMQE
YLNHFLGNLDIVNSREVCRFLEVSMLSFSPEYGPKLKEDYIMVKHLPKFSKSDDDSNRCC
GCCWFCCCNDNWQKVWGVLKPGFLALLEDPFDAKLLDIIVFDVLPVSNGNDGVDISLAVE
LKDHNPLRHAFKVTSGNRSIRIRAKNSAKVKDWVASINDAALRPPEGWCHPHRFGSYAPP
RGLTDDGSQAQWFVDGGAAFAAIAAAIENAKSEIFICGWWVCPELYLRRPFDPHTSSRLD
NLLENKAKQGVQIYILIYKEVALALKINSVYSKRRLLGIHENVRVLRYPDHFSSGVYLWS
HHEKLVIVDNQVCFIGGLDLCFGRYDTFEHKVGDNPSVTWPGKDYYNPRESEPNTWEDAL
KDELERKKHPRMPWHDVHCALWGPPCRDVARHFVQRWNYAKRNKAPYEDSIPLLMPQHHM
VIPHYMGRQEESDIESKKEEDSIRGIRRDDSFSSRSSLQDIPLLLPHEPVDQDGSSGGHK
ENGTNNRNGPFSFRKSKIEPVDGDTPMRGFVDDRNGLDLPVAKRGSNAIDSEWWETQDHD
YQVGSPDETGQVGPRTSCRCQIIRSVSQWSAGTSQVEESIHSAYRSLIDKAEHFIYIENQ
FFISGLSGDDTVKNRVLEALYKRILRAHNEKKIFRVVVVIPLLPGFQGGIDDSGAASVRA
IMHWQYRTIYRGHNSILTNLYNTIGVKAHDYISFYGLRAYGKLSEDGPVATSQVYVHSKI
MIVDDRAALIGSANINDRSLLGSRDSEIGVLIEDTELVDSRMAGKPWKAGKFSSSLRLSL
WSEHLGLRTGEIDQIIDPVSDSTYKEIWMATAKTNTMIYQDVFSCVPNDLIHSRMAFRQS
LSYWKEKLGHTTIDLGIAPEKLESYHNGDIKRSDPMDRLKAIKGHLVSFPLDFMCKEDLR
PVFNESEYYASPQVFH
Download sequence
Identical sequences Q9LRZ5
AT3G16785.1 3702.AT3G16785.1-P NP_188302.2.80155 AR2251 AT3G16785.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]