SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G17280.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G17280.1
Domain Number 1 Region: 1-53,82-131
Classification Level Classification E-value
Superfamily F-box domain 2.09e-18
Family F-box domain 0.0048
Further Details:      
 
Domain Number 2 Region: 236-305
Classification Level Classification E-value
Superfamily PH domain-like 0.0000148
Family Pleckstrin-homology domain (PH domain) 0.0073
Further Details:      
 
Weak hits

Sequence:  AT3G17280.1
Domain Number - Region: 100-226
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0036
Family SGL-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G17280.1
Sequence length 386
Sequence
MTTISDLPYDLLPEILSRLPTKSIPKLKTTCKKWYALFKDPKFVEKKLGKAARETVFLMN
HEVNSISVDIHGIPKGYSVSMDFTGTLTIPEGSDLEIFRIHHCNGLFLCATMNCRLVVWN
PCTGQITWIIPRTRYDSDDIYALGCGDDKSSSLHSYKILRCCDDNQKKPVSEIYDFSSSS
WRVLDGVTANCFIECNGVALKESAYWYASDKRETPKGKFILRFDFATERFARLCLPLNFQ
RDRDNKSVVVSVVGEEKLALLQQFDHRVHGLKYSKIKIWVTDTKIGEGKDLSWSNILVEE
LADDNLPSVTSFLLDEEKKVAVCSDAVCSDTDTEDEDRRRIYIVGEGVDEFVYDEVSTET
SHNWPFLVSYVPNLVHIEKDAPIVEV
Download sequence
Identical sequences Q9LUU3
3702.AT3G17280.1-P NP_001319575.1.80155 NP_188354.1.80155 GO.13088 AT3G17280.1 AT3G17280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]