SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G19510.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G19510.1
Domain Number 1 Region: 257-322
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000062
Family PHD domain 0.0099
Further Details:      
 
Domain Number 2 Region: 617-668
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000222
Family Homeodomain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G19510.1
Sequence length 723
Sequence
MYKAVSKRVTRSSGSGLKQTNVDNGGEISPTVDRVSEQGKSSEAGSHMPTDANGNGHLHH
EIMDHGKGNEEQKPTPQTVKKDSNTNTKFSGSHRELVIGLPCRGQFEIHNRSRASTSSKR
LGGGGERNVLFASHKRAQRSKEDAGPSSVVANSTPVGRPKKKNKTMNKGQVREDDEYTRI
KKKLRYFLNRINYEQSLIDAYSLEGWKGSSLEKIRPEKELERATKEILRRKLKIRDLFQH
LDTLCAEGSLPESLFDTDGEISSEDIFCAKCGSKDLSVDNDIILCDGFCDRGFHQYCLEP
PLRKEDIPPDDEGWLCPGCDCKDDSLDLLNDSLGTKFSVSDSWEKIFPEAAAALVGGGQN
LDCDLPSDDSDDEEYDPDCLNDNENDEDGSDDNEESENEDGSSDETEFTSASDEMIESFK
EGKDIMKDVMALPSDDSEDDDYDPDAPTCDDDKESSNSDCTSDTEDLETSFKGDETNQQA
EDTPLEDPGRQTSQLQGDAILESDVGLDDGPAGVSRRRNVERLDYKKLYDEEYDNVPTSS
SDDDDWDKTARMGKEDSESEDEGDTVPLKQSSNAEDHTSKKLIRKSKRADKKDTLEMPQE
GPGENGGSGEIEKSSSSACKQTDPKTQRLYISFQENQYPDKATKESLAKELQMTVKQVNN
WFKHRRWSINSKPLVSEENVEKLKTGKEGECETSVAGSSKQTMETESVAEKPTNTGSRKR
RRK
Download sequence
Identical sequences Q04996
AT3G19510.1 AT3G19510.1 3702.AT3G19510.1-P NP_001326497.1.80155 NP_188582.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]