SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G23490.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G23490.1
Domain Number 1 Region: 85-150
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 3.14e-27
Family Cyanase C-terminal domain 0.00045
Further Details:      
 
Domain Number 2 Region: 6-81
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000236
Family Phage repressors 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G23490.1
Sequence length 168
Sequence
MEAAKKQSVTNQLLAVKSASGKTFSQLAAETGLTNVYVAQLLRRQAQLKPDTVPKLKEAL
PALTDELIGDMMSPPWRSYDPNLIQEPTIYRLNEAVMHFGESIKEIINEDFGDGIMSAID
FYCSVDKIKGVDGNNRVVVTLDGKYLSHSEQRTENMVSRLNLKGGTSE
Download sequence
Identical sequences A0A178VD28 O22683
AT3G23490.1 NP_001327887.1.80155 NP_188991.1.80155 AT3G23490.1 3702.AT3G23490.1-P

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]