SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G25890.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G25890.2
Domain Number 1 Region: 130-177
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000719
Family GCC-box binding domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G25890.2
Sequence length 332
Sequence
MAERKKRSSIQTNKPNKKPMKKKPFQLNHLPGLSEDLKTMRKLRFVVNDPYATDYSSSEE
EERSQRRKRYVCEIDLPFAQAATQAESESSYCQESNNNGVSKTKISACSKKVLRSKASPV
VGRSSTTVSKPVGVRQRKWGKWAAEIRHPITKVRTWLGTYETLEQAADAYATKKLEFDAL
AAATSAASSVLSNESGSMISASGSSIDLDKKLVDSTLDQQAGESKKASFDFDFADLQIPE
MGCFIDDSFIPNACELDFLLTEENNNQMLDDYCGIDDLDIIGLECDGPSELPDYDFSDVE
IDLGLIGTTIDKYAFVDHIATTTPTPLNIACP
Download sequence
Identical sequences A0A178VGC2 Q9LUA2
3702.AT3G25890.2-P NP_001078209.1.80155 NP_189218.1.80155 AT3G25890.1 AT3G25890.2 AT3G25890.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]