SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G28730.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G28730.1
Domain Number 1 Region: 206-440
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-78
Family SSRP1-like 0.00000656
Further Details:      
 
Domain Number 2 Region: 548-631
Classification Level Classification E-value
Superfamily HMG-box 4.97e-28
Family HMG-box 0.000071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G28730.1
Sequence length 646
Sequence
MADGHSFNNISLSGRGGKNPGLLKINSGGIQWKKQGGGKAVEVDRSDIVSVSWTKVTKSN
QLGVKTKDGLYYKFVGFRDQDVPSLSSFFQSSYGKTPDEKQLSVSGRNWGEVDLHGNTLT
FLVGSKQAFEVSLADVSQTQLQGKNDVTLEFHVDDTAGANEKDSLMEISFHIPNSNTQFV
GDENRPPSQVFNDTIVAMADVSPGVEDAVVTFESIAILTPRGRYNVELHLSFLRLQGQAN
DFKIQYSSVVRLFLLPKSNQPHTFVVISLDPPIRKGQTMYPHIVMQFETDTVVESELSIS
DELMNTKFKDKLERSYKGLIHEVFTTVLRWLSGAKITKPGKFRSSQDGFAVKSSLKAEDG
VLYPLEKGFFFLPKPPTLILHDEIDYVEFERHAAGGANMHYFDLLIRLKTDHEHLFRNIQ
RNEYHNLYTFISSKGLKIMNLGGAGTADGVAAVLGDNDDDDAVDPHLTRIRNQAADESDE
EDEDFVMGEDDDGGSPTDDSGGDDSDASEGGVGEIKEKSIKKEPKKEASSSKGLPPKRKT
VAADEGSSKRKKPKKKKDPNAPKRAMSGFMFFSQMERDNIKKEHPGIAFGEVGKVLGDKW
RQMSADDKEPYEAKAQVDKQRYKDEISDYKNPQPMNVDSGNDSDSN
Download sequence
Identical sequences A0A178VCP0 Q05153
GO.14935 NP_189515.1.80155 3702.AT3G28730.1-P AT3G28730.1 AT3G28730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]