SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G43230.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G43230.1
Domain Number 1 Region: 170-239
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G43230.1
Sequence length 485
Sequence
MATLNGKASPYSEENIKFKYDDYDDDDDDDDGSGSGSGGGYEDGPKWSVQSIPTKKEVEY
PIIDSGDYVDDGYDSSGELSTTTTPPIQGNEKPEVNLKNVLTGLIAIVTGRNKNPLDQKN
PSSNVSFLGSGTNGDTFVHSSVYIPSAPPLLEPSGINYSVYKELLEAEPPEWLPDSLAST
CMQCSTPFTAITCGRHHCRFCGGIFCRNCSKGRCLMPSRFRERNPQRVCDSCYERLDPLQ
CVLINSISNAVQVAKHDVVDWTCSRGWLNLPVGLSMEDEIYKAANTLRGYCQVARLDPEK
SIPHAVLSRAKGLAIITVAKAGALLSYKLGTGLVISRRPDGSWSAPSAILSVGLGWGAQI
GGELMDFIIVLHDVKAVKTFCSRMHFSLGAGCSAAAGPIGRVLEADLRAGDKGSGVCYTY
SRSKGAFVGVSLEGNLVATRRDMNVKFYGDPYLSTSDILLGMVDQPKAAEPLYTALRELY
ARLRP
Download sequence
Identical sequences Q9LXL1
NP_189909.1.80155 AT3G43230.1 3702.AT3G43230.1-P AT3G43230.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]