SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G43240.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G43240.1
Domain Number 1 Region: 567-680
Classification Level Classification E-value
Superfamily ARID-like 1.92e-16
Family ARID domain 0.0021
Further Details:      
 
Domain Number 2 Region: 662-731
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000021
Family PHD domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G43240.1
Sequence length 747
Sequence
MFHGQGFSRNRCNVVAVVSGAELCDTNNQIDGTSHQPKYPFPDLSSSGRLKFQVLNNPTP
EEFQVAVNSSATDFVYLQGEHSGDSDEVGPLVLGYTDFSTPDALVTLFGSTLPTTVYLEL
PNGEELAQALYSKGVQYVIYWKNVFSKYAACHFRHSLFSVIQSSCSDTWDVFHVAEASFR
LYCTSDNAVLPSNSNRKMNYEMGPCLLGEPPKIDVVSPEADELEEENSLESLPSIKIYDE
DVTVRFLLCGPPCTVDTFLLGSLMDGLNALLRIEMRGSKLHNRSSAPAPPLQAGTFTRGV
VTMRCDVSTCSSAHISMLVSGNAQTCFSDQLLENHIKHEVVEKIQLVHSVVNSEETKRGF
SEPRRSASIACGASVCEVSMQVPTWALQVLRQLAPDVSYRSLVVLGVASIQGLSVASFEK
DDAERLLFFCGQQINDTSNHDALLSKIPNWLTPPLPTRKRSEPCRESKEIENGGPTSRKI
NVAALRPIPHTRRHKMIPFSGYSEIGRFDGDHTKGSLPMPPKHGASGGTPVTHRKAFSGS
YQRKQIISLNPLPLKKHDCGRAHIQVCSEEEFLRDVMQFLLIRGHTRLVPPGGLAEFPDA
VLNSKRLDLFNLYREVVSRGGFHVGNGINWKGQVFSKMRNHTLTNRMTGVGNTLKRHYET
YLLEYEYAHDDVDGECCLICRSSTAGDWVNCGSCGEWAHFGCDRRPGLGAFKDYAKTDGL
EYVCPNCSVSNYRKKSQKTSNGGLLVP
Download sequence
Identical sequences Q6NQ79
3702.AT3G43240.1-P AT3G43240.1 NP_189910.2.80155 AT3G43240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]