SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G47070.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G47070.1
Domain Number 1 Region: 24-100
Classification Level Classification E-value
Superfamily TSP9-like 3.4e-23
Family TSP9-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G47070.1
Sequence length 100
Sequence
MVSSLLMSFAPATVRVYATSTKGGSGGPKEEKNPIDFVLGFMTKQDQFYETNPLLKKVDE
KEGTTTGGRGTVRGGKNSAPTPVPKKSEGGFGGLGSLFKK
Download sequence
Identical sequences Q9SD66
NP_190291.1.80155 3702.AT3G47070.1-P GO.11917 AT3G47070.1 AT3G47070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]