SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G47660.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G47660.1
Domain Number 1 Region: 252-635
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.37e-86
Family Regulator of chromosome condensation RCC1 0.0022
Further Details:      
 
Domain Number 2 Region: 17-121
Classification Level Classification E-value
Superfamily PH domain-like 3.89e-21
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 639-707
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  AT3G47660.1
Domain Number - Region: 872-923
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0745
Family Mitotic arrest deficient-like 1, Mad1 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G47660.1
Sequence length 954
Sequence
MRFSIRKLRSVPTDRENEQAIAILKKGAYLLKYGRRGKPKFYPFRLSSDEIYLLWYCGKK
EKRLKLSSVTRIIPGQRTAVFRRYPQPTKEYQSFSLIYGERSLDLDKDEAEFWLTTLRAL
LSRNNSSALVLHSRSRSLAPENGEQSSSSQNSKSNIRSVSSDTSYEEHAKKASGSHCNTP
QRLGKVFSEVLSQTAVLKALSLDELVHKPHTSPPETIENRPTNHSSPGVDTSKYSISSAV
SSSSQGSTFEDLKSLCDVFVWGESIGDGLLGGGMHKSGSSSSLMTDSFLPKVLKSHVALD
AQSISCGTNYAVLVTKQGQMYSWGEESGGRLGHGVCSYVPHPKLIDEFNGSTVELADCGE
FHTCAVTASGDLYAWGDGDHNAGLLGLGSGASHWKPVRILGQMEGIYVKAISCGPWHTAF
VTSEGKLFTFGDGTFGALGHGDRISTNIPREVEALNGCRTIKAACGVWHSAAVVSVFGEA
TSSGKLFTWGDGDDGRLGHGDIECRLIPSCVTELDTTSFQQVACGQSITVALSMSGQVYA
MGTADPSHDIVRAPSCIEGGLGKSFVQEVACGFHHIAVLNSKAEVYTWGKGSNGQLGHGD
TEYRCMPTLVKALKGKQVRKVVCGSNYTATICLHKPITGTDSTKCSGCRHPFNYMRKLHN
CYNCGSVFCNSCTSKKSLAAAMAPKTNRPYRVCDDCYIKLEGIRESLATPANSARFSNAS
LPSSYEMDEIGITPQRQLLRVDSFDFFRQTKHADLKTIGETSGGSCTSSIHSNMDIKGSF
NLKGIRRLSRLTSFDSVQEEGKQRTKHCASKSDTSSLIRHSVTCGLPFSRRGSVELFPLS
IKSSPVESVATTSDFTTDITDHELLQEVPKKSNQCLSHEISVLKAQVEELTLKSKKLETE
LGKTSKKLEVAVLMARDDAEKIKSSEEIVRSLTLQLMNTTKKEVDKTRRHRNSF
Download sequence
Identical sequences F4JCN3
3702.AT3G47660.1-P NP_190350.4.80155 AT3G47660.1 AT3G47660.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]