SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G49610.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G49610.1
Domain Number 1 Region: 207-332
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000196
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G49610.1
Sequence length 334
Sequence
MNRNHHDHLDAAGKDMWSRLSDLADKADMLYEREGISKDRKSVSEEEEEKKTRFSILVDL
VGRLCDQEERRTLGSSPTKTNTLFEGSEKSHLDHHLDHLPQKPRSSLECFFTRVYTRRNH
NNVSTSSSLFNTDEFERTETKSPTIRNSQSSPSSCLMENTKRKRYQSSGKSKKPKFDPFS
LTAARETPEWLLDVMRKMKGAEGPIKLIYEKTLTATDVKPSESRLLIPFNKLLRNDFLTP
EESRAIAIDKEEEEEDTKKIGVKTIIVNQFSKEWSLRFLIWVMKKKKSGNGTLYYTLNRG
WNGVVSGNKLKANDNISLWTFRCGGVLCFALEKE
Download sequence
Identical sequences Q9SCJ8
3702.AT3G49610.1-P AT3G49610.1 AT3G49610.1 NP_190530.1.80155 GO.14545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]