SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G51120.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G51120.1
Domain Number 1 Region: 454-582
Classification Level Classification E-value
Superfamily Plus3-like 1.31e-25
Family Plus3 0.0029
Further Details:      
 
Domain Number 2 Region: 317-394
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 2.62e-21
Family SWIB/MDM2 domain 0.00066
Further Details:      
 
Domain Number 3 Region: 713-769
Classification Level Classification E-value
Superfamily GYF domain 1.57e-16
Family GYF domain 0.00064
Further Details:      
 
Domain Number 4 Region: 106-167
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000012
Family PHD domain 0.0098
Further Details:      
 
Domain Number 5 Region: 1267-1291
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000497
Family CCCH zinc finger 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AT3G51120.1
Sequence length 1292
Sequence
MENQQKQLQQGVPELASLAGREESSVRGIDLMRVDQCEEIGVNQVPALSVPASTVAGAVA
VPMSNEQEVKVIDEAAPIKRKRGRPPRAQANTPLHIRPPPPPPKKEDKEEDVCFICFDGG
DLVLCDRRNCPKAYHPACIKRDEAFFRTTAKWNCGWHICGTCQKASSYMCYTCTFSVCKR
CIKDADYVIVRGNMGLCGTCIKPIMLIENIAQGDNEAVKVDFDDKLSWEYLFKVYWLCLK
EELSLTVDELTRANNPWKEVPNTAPKVESQNDHTNNRALDVAVNGTKRRRTSDSPTLPNK
LDGKNPSNILKKAPGDTSWATKELLEFVSFMKNGDTSVLSQFDVQGLLLDYIKKKNLRDP
LQKSQVLCDQMLVKLFGKQRVGHFEMLKLLESHVLIQEKPKGAKTTNGETTHAVPSQIEE
DSVHDPMVRDRRRKMRRKTDGRVQNENLDAYAAIDVHNINLIYLRRKFLESLLDDINKVD
EKVVGTILRIKVSGSDQKLDIHRLVQVVGTSKAIASYQLGAKTTDVMLEILNLDKREVIS
IDQLSDQNITEDECKRLRQSIKCGLNKRLTVVDILKTAATLQAMRINEALEAEILKLNHL
RDRAKKLELLKSPEERQRLLQEVPEVHTDPSMDPSHALSEDAGLGTRKQDNHVKAQSKGP
QNKGVNLNNVGNNVQKKYDAPILRSRNNVHADKDDCSKVHNNSSNIQETGKDDEESEIWH
YRDPTGKTQGPFSMVQLRRWKSSGHFPPYLRIWRAHENQDESVLLTDALAGRFDKATTLP
SSSSLPQELKPSPHDSGRTGADVNCLQKNQMPVNTSATSSSSSTVTAHSNDPKEKQVVAL
VACSGKVEDGNSVRPQPQVSCPASISVVPGHVVTPDVRETPGTDQYNTVRADGNHNTTKT
LEDETNGGSVSINGSVHAPNLNQESHFLDFPSPTPKSSPEDLEAQAAETIQSLSSCVLVK
GPSGVTWSTTTTSTTDAATTTSSVVVTGGQLPQVIQQNTVVLAAPSVKPIELAADHATAT
QTSDNTQVAQASGWPAIVADPDECDESVSDLLAEVEAMEQNGLPSSPTSTFHCDDDDDLK
GPEKDFFNPVARMSLTPETCRLDVSQTSILDNVSAGKSSMLTEAKDNTPFSHCGTAGPEL
LLFAPPPPPPTAISHDLTLTTTALRLGSETTVEAGTVERLPKSVLGVSSEPSPRSLSSHD
SSSARGSTERSPRVSQPKRSSGHSRDRQWLNNGHNSSFNNSHNNRQWPYSNSHGYDHGSG
SYAAHPPKGLKICKFYESGYCKRGASCSFWHP
Download sequence
Identical sequences Q9SD34
AT3G51120.1 3702.AT3G51120.1-P AT3G51120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]