SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G53680.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G53680.1
Domain Number 1 Region: 483-532
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000037
Family PHD domain 0.012
Further Details:      
 
Domain Number 2 Region: 715-810
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000986
Family N-acetyl transferase, NAT 0.013
Further Details:      
 
Domain Number 3 Region: 564-622
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000014
Family PHD domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G53680.1
Sequence length 841
Sequence
MGEATVCFAKENSETKKDLKRDRLCFEQDNLDEEELYSSNKRQTKEPSNDDMKSEISNPV
PSPVVDNASSFRDITSNPAKSSSGDRVGSCSGSYETITDEKHSEYCSSLANSDAVPSSFE
REIPKHLSTTGITKITFKLSKRNEDFCDLPMIQEHTWEGYPSNVASSTLGVKMLKKIDST
NFLSNVKKLLGTGILDGARVKYLSTSAARELQGIIHSGGYLCGCTACDFSKVLGAYEFER
HAGGKTKHPNNHIYLENGRPVYNVIQELRIAPPDVLEEVIRKVAGSALSEEGFQAWKGSF
QQDKNMTEDDSNHIMDHSFQSLVSYPGSGWSLDESQSSTPCFPEDNYFREKICTKDTRHA
HKPKAKKLTSHMFGMGCHKKVSGGGKWKRDNDLHRLLFLPNGLPDGTELAYYVKSQKLLQ
GYKQGSGIVCSCCDTKISPSQFEAHAGMAGRRQPYRRIHISSGLSLHDIAVSLADGGHVI
TTGDSDDMCSICGNGGDLLLCAGCPQAFHTACLKFQSMPEGTWYCSSCNDGPTSCKIATA
SDPNLKPIVIRLTRVVKAPESEIGGCVFCRSHDFSIGKFDDRTVILCDQCEKEYHVGCLR
ENELCDLKGIPQDKWFCCSDCSRIHRVLQSSASCGPQTIPTLLLDTISRKYREKGIYIDN
GNTVEWRMLSGKSRYPEHLPLLSRAATIFRECFDPIVAKSGRDLIPVMVYGRNISGQEFG
GMYCLVLMVNSLVVSAALLRIFGQKVAELPIVATSREYQGRGYFQGLFACVENLLSSLNV
ENLLLPAAEEAESIWTNKFGFTKMTEHRLQRYQREVQLTIFKGTSMLEKKVPSFSESTSI
I
Download sequence
Identical sequences C0SVE6
AT3G53680.1 AT3G53680.1 NP_190936.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]