SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G54320.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G54320.1
Domain Number 1 Region: 166-227
Classification Level Classification E-value
Superfamily DNA-binding domain 5.89e-18
Family GCC-box binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 64-132
Classification Level Classification E-value
Superfamily DNA-binding domain 2.29e-16
Family GCC-box binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G54320.1
Sequence length 438
Sequence
MKKRLTTSTCSSSPSSSVSSSTTTSSPIQSEAPRPKRAKRAKKSSPSGDKSHNPTSPAST
RRSSIYRGVTRHRWTGRFEAHLWDKSSWNSIQNKKGKQVYLGAYDSEEAAAHTYDLAALK
YWGPDTILNFPAETYTKELEEMQRVTKEEYLASLRRQSSGFSRGVSKYRGVARHHHNGRW
EARIGRVFGNKYLYLGTYNTQEEAAAAYDMAAIEYRGANAVTNFDISNYIDRLKKKGVFP
FPVNQANHQEGILVEAKQEVETREAKEEPREEVKQQYVEEPPQEEEEKEEEKAEQQEAEI
VGYSEEAAVVNCCIDSSTIMEMDRCGDNNELAWNFCMMDTGFSPFLTDQNLANENPIEYP
ELFNELAFEDNIDFMFDDGKHECLNLENLDCCVVGRESPPSSSSPLSCLSTDSASSTTTT
TTSVSCNYLFQGLFVGSE
Download sequence
Identical sequences NP_191000.3.80155 3702.AT3G54320.1-P AT3G54320.1 AT3G54320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]