SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G55630.1 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G55630.1
Domain Number 1 Region: 16-256
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.06e-70
Family Folylpolyglutamate synthetase 0.00011
Further Details:      
 
Domain Number 2 Region: 282-380,425-469
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 0.000000000275
Family Folylpolyglutamate synthetase, C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G55630.1
Sequence length 470
Sequence
MATEDDGELSARYQNTLDALSSLITKRGRLASNNQSHRFRLLFHYLKVLELEDAVSQMKI
IHVAGTKGKGSTCTFAESILRCYGLRTGLFTSPHLIDVRERFRLNGIEISQEKFVNYFWC
CFHKLKEKTSNEVDVVILEVGLGGRFDATNVIQKPVVCGISSLGYDHMEILGYTLAEIAA
EKAGIFKSGVPAFTVAQPDEAMRVLNEKASKLEVNLQVVEPLDSSQRLGLQGEHQYLNAG
LAVALCSTFLKEIGIEDKNGLDQTNGLPEKFISGLSNAYLMGRAMIVPDSELPEEIVYYL
DGAHSPESMEACAIWFSKQIKQNQERNQKRSEQILLFNCMSVRDPSLLLPRLRSKCIDQG
VDFKRAVFVPNVSVYNQVGSSTNVGTRVESMSWQFGLQRIWESLARGEAKSNSKSDSKGK
EEEKSFVFSSLPVAVDWLRDNARQSKQVRFQVLVTGSLHLVGDLLRFIKK
Download sequence
Identical sequences NP_851017.1.80155 AT3G55630.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]