SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G55630.2 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G55630.2
Domain Number 1 Region: 16-277
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 7.33e-81
Family Folylpolyglutamate synthetase 0.0000509
Further Details:      
 
Domain Number 2 Region: 303-401,446-490
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 0.000000000305
Family Folylpolyglutamate synthetase, C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AT3G55630.2
Sequence length 491
Sequence
MATEDDGELSARYQNTLDALSSLITKRGRLASNNQSHRFRLLFHYLKVLELEDAVSQMKI
IHVAGTKGKGSTCTFAESILRCYGLRTGLFTSPHLIDVRERFRLNGIEISQEKFVNYFWC
CFHKLKEKTSNEVPMPTYFCFLALLAFKIFTTEQVDVVILEVGLGGRFDATNIQKPVVCG
ISSLGYDHMEILGYTLAEIAAEKAGIFKSGVPAFTVAQPDEAMRVLNEKASKLEVNLQVV
EPLDSSQRLGLQGEHQYLNAGLAVALCSTFLKEIGIEDKNGLDQTNGLPEKFISGLSNAY
LMGRAMIVPDSELPEEIVYYLDGAHSPESMEACAIWFSKQIKQNQERNQKRSEQILLFNC
MSVRDPSLLLPRLRSKCIDQGVDFKRAVFVPNVSVYNQVGSSTNVGTRVESMSWQFGLQR
IWESLARGEAKSNSKSDSKGKEEEKSFVFSSLPVAVDWLRDNARQSKQVRFQVLVTGSLH
LVGDLLRFIKK
Download sequence
Identical sequences NP_851018.1.80155 AT3G55630.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]