SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AT3G55630.3 from Arabidopsis thaliana 10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AT3G55630.3
Domain Number 1 Region: 16-278
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, catalytic domain 1.6e-80
Family Folylpolyglutamate synthetase 0.000045
Further Details:      
 
Domain Number 2 Region: 304-402,447-491
Classification Level Classification E-value
Superfamily MurD-like peptide ligases, peptide-binding domain 0.000000000305
Family Folylpolyglutamate synthetase, C-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AT3G55630.3
Sequence length 492
Sequence
MATEDDGELSARYQNTLDALSSLITKRGRLASNNQSHRFRLLFHYLKVLELEDAVSQMKI
IHVAGTKGKGSTCTFAESILRCYGLRTGLFTSPHLIDVRERFRLNGIEISQEKFVNYFWC
CFHKLKEKTSNEVPMPTYFCFLALLAFKIFTTEQVDVVILEVGLGGRFDATNVIQKPVVC
GISSLGYDHMEILGYTLAEIAAEKAGIFKSGVPAFTVAQPDEAMRVLNEKASKLEVNLQV
VEPLDSSQRLGLQGEHQYLNAGLAVALCSTFLKEIGIEDKNGLDQTNGLPEKFISGLSNA
YLMGRAMIVPDSELPEEIVYYLDGAHSPESMEACAIWFSKQIKQNQERNQKRSEQILLFN
CMSVRDPSLLLPRLRSKCIDQGVDFKRAVFVPNVSVYNQVGSSTNVGTRVESMSWQFGLQ
RIWESLARGEAKSNSKSDSKGKEEEKSFVFSSLPVAVDWLRDNARQSKQVRFQVLVTGSL
HLVGDLLRFIKK
Download sequence
Identical sequences A0A178V748 Q8W035
AT3G55630.3 AT3G55630.3 3702.AT3G55630.3-P NP_567026.3.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]